Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0008tonB1YP_361739.1energy transducer TonB protein

tonB1 XCV0008
XCV0007
XCV0007
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0009
XCV0009
ID tonB1
AC YP_361739.1
LT XCV0008
SY
OR NC_007508 from 10935 to 11606 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE energy transducer TonB protein
IP Gram-negative bacterial tonB protein
CL
EC
GO Biological Process: iron ion transport (GO:0006826)
Biological Process: protein transport (GO:0015031)
Cellular Component: membrane (GO:0016020)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: protein transporter activity (GO:0008565)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)
PM
AN
SQ 223 aa
 
........10........20........30........40........50
| | | | |
MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPAVAPKA
PAEKERTTMVTLVDAPPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPP
PEAPVVDVPEPRPSDIVTPPSPPSPPAPPSDIGASVDISSKNMNPPKYPP
AAFRAGVQGEVILIVDVDASGNVTNVSVEKSSRNRDLDRAAMDAARKWKF
NASTVNGQKAAGRVRVPVNFALN
xansp

YP_364158.1 lcl|XCV2427

134

220

S=127 I=34 E=4.6621e-09

putative secreted protein

xansp

YP_365210.1 lcl|blaR1-XCV3479

142

223

S=125 I=32 E=7.53077e-09

putative BlaR1 antirepressor (fragment)

xansp

YP_364661.1 lcl|tonB4-XCV2930

146

223

S=120 I=39 E=3.58611e-08

TonB-like protein

xansp

YP_363423.1 lcl|tonB2-XCV1692

146

220

S=98 I=31 E=1.46998e-05

TonB-like protein

xansp

YP_365688.1 lcl|XCV3957

135

180

S=97 I=37 E=1.92617e-05

putative secreted protein

xansp

YP_363424.1 lcl|tonB3-XCV1693

142

220

S=95 I=37 E=3.57714e-05

TonB-like protein

pubmed

131

223

S=393 I=84 E=3.42223e-39

TonB

Pubmed 12646254

 

prodomImg

pubmed

1

65

S=271 I=82 E=2.05607e-24

TonB

Pubmed 12646254

 

prodomImg

pubmed

131

223

S=393 I=84 E=3.42223e-39

Protein tonB ; Cell inner membrane Periplasm transport Repeat Signal-anchor Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

1

65

S=271 I=82 E=2.05607e-24

Protein tonB ; Cell inner membrane Periplasm transport Repeat Signal-anchor Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

144

223

S=120 I=36 E=4.10409e-06

Protein tonB2 ; Cell inner membrane Periplasm transport Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

145

223

S=115 I=34 E=1.41547e-05

TonB protein

Pubmed 15689115

 

prodomImg

sp

131

223

S=393 I=84 E=2.16332e-39

Protein tonB - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

65

S=271 I=82 E=1.29972e-24

Protein tonB - Xanthomonas campestris pv. campestris

 

prodomImg

sp

131

223

S=393 I=84 E=2.16332e-39

Protein tonB - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

1

65

S=271 I=82 E=1.29972e-24

Protein tonB - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

144

223

S=120 I=36 E=2.59436e-06

Protein tonB2 - Pseudomonas aeruginosa

Pubmed 10689178,

 

prodomImg

trembl

131

223

S=397 I=85 E=7.52382e-39

TonB protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

65

S=271 I=82 E=1.34425e-23

TonB protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

131

223

S=393 I=84 E=2.44127e-38

TonB protein - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PR01217]

104

129

-

Iprscan [PR01217]

46

67

-

Iprscan [PR01217]

67

83

-

Iprscan [PR01217]

84

101

-

Iprscan IPR003538 [PR01374]

140

161

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

161

179

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

69

79

Gram-negative bacterial tonB protein

Iprscan IPR006260 [TIGR01352]

146

223

TonB, C-terminal

Iprscan [seg]

183

196

-

Iprscan [seg]

44

55

-

Iprscan [seg]

66

130

-

Iprscan [SignalP-NN(euk)]

1

38

-

Iprscan [tmhmm]

21

43

-

Iprscan [SSF74653]

92

223

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BshlGMi0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
trembl

TrEMBL ncbi-blastp

63 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits