Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC4216NP_639550.1bifunctional oxidoreductase/alginate lyase

XCC4216
XCC4215
XCC4215
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC4217
XCC4217
ID
AC NP_639550.1
LT XCC4216
SY
OR NC_003902 from 5034375 to 5035382 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE bifunctional oxidoreductase/alginate lyase
IP Alcohol dehydrogenase superfamily, zinc-containing;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MKAIAYPQHGLPIDDPRALVALDLPLPTPGPRDLRVRIHAISVNPVDTKV
RATAPVEAPRVLGWDASGVVDAVGDEVTLFQPGDAVYYAGALTRPGTNAE
YHLVDERLVGRKPATLDDASAAALPLTAITAWELLFDRLGIVEGGGAGQT
LLVVGAAGGVGSILVQLARALTQLTVVGTASRPQTQDWVYALGAHHVIDH
TEPLAAGLQRIGIAQVQHVASLTHTDQHFAQLVEVLAPQGQLALIDDPAT
LDALPLKRKSLSLHWELMFTRSLFATDDMIAQHHLLNRVAALVESGVLRT
TLGEHYGRITVDNLRRAHAALESHRTRGKLVLEGF
xansp

NP_636320.1 lcl|XCC0934

1

335

S=775 I=51 E=2.43834e-87

oxidoreductase

xansp

NP_638078.1 lcl|XCC2730

10

245

S=120 I=27 E=5.18053e-08

alcohol dehydrogenase

xansp

NP_636133.1 lcl|XCC0742

15

137

S=111 I=36 E=7.14681e-07

quinone reductase

xansp

NP_639466.1 lcl|XCC4127

1

135

S=105 I=33 E=3.28663e-06

nuclear receptor binding factor related protein

pubmed

1

335

S=851 I=52 E=1.65184e-94

Putative zinc-binding dehydrogenase

Pubmed 15574953

 

prodomImg

pubmed

1

332

S=522 I=36 E=1.3775e-54

Zinc-type alcohol dehydrogenase-like protein SA1988 ; Metal-binding Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

27

333

S=277 I=33 E=5.61772e-25

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

23

332

S=257 I=29 E=1.58281e-22

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

1

202

S=209 I=33 E=9.66514e-17

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

18

138

S=205 I=39 E=3.63711e-16

Glycosyl hydrolase

Pubmed 17086451

 

prodomImg

pubmed

23

202

S=190 I=30 E=2.51767e-14

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP Polymorphism

Pubmed 8466529,8088825

 

prodomImg

pubmed

11

332

S=187 I=25 E=5.0134e-14

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

pubmed

23

202

S=187 I=31 E=5.61509e-14

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

1

200

S=186 I=35 E=6.12663e-14

ORF2 protein (Putative oxidoreductase)

Pubmed 7929165

 

prodomImg

sp

1

332

S=557 I=37 E=4.6462e-59

Zinc-type alcohol dehydrogenase-like protein SERP1785 - Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

 

prodomImg

sp

1

332

S=552 I=37 E=1.73325e-58

Zinc-type alcohol dehydrogenase-like protein SE_1777 - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

sp

1

332

S=529 I=36 E=1.13768e-55

Zinc-type alcohol dehydrogenase-like protein MW2112 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

1

332

S=529 I=36 E=1.13768e-55

Zinc-type alcohol dehydrogenase-like protein SAS2087 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

sp

1

332

S=527 I=36 E=1.98772e-55

Zinc-type alcohol dehydrogenase-like protein SAR2277 - Staphylococcus aureus (strain MRSA252)

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

1

156

-

Iprscan IPR002085 [PTHR11695]

18

333

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF34]

18

333

-

Iprscan IPR013149 [PF00107]

147

285

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

31

112

Alcohol dehydrogenase GroES-like

Iprscan IPR014182 [TIGR02817]

2

335

Alcohol dehydrogenase, zinc-binding type 1

Iprscan IPR002364 [PS01162]

148

169

Quinone oxidoreductase/zeta-crystallin, conserved site

Iprscan [seg]

144

161

-

Iprscan IPR011032 [SSF50129]

1

153

GroES-like

Iprscan IPR016040 [SSF51735]

120

300

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one flvFZP6b)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

36 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits