Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC4009NP_639348.1dehydratase

XCC4009
XCC4008
XCC4008
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC4010
XCC4010
ID
AC NP_639348.1
LT XCC4009
SY
OR NC_003902 from 4753327 to 4753614 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE dehydratase
IP Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase, FabA/FabZ
CL
EC
GO
PM
AN
SQ 95 aa
 
........10........20........30........40........50
| | | | |
MDFVVPHDHPSLPGHFPGRPVVPGVVVLDHVLQAVEAVHGARAPARLPQV
KFVQPLLPGQTASVTLEGDGPRWRFRVQRDGQLLVSGELVAEAAA
pubmed

1

95

S=331 I=74 E=2.09335e-32

Putative dehydratase

Pubmed 12057948

 

prodomImg

Iprscan [G3DSA:3.10.129.10]

5

94

-

Iprscan IPR013114 [PF07977]

5

94

Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase, FabA/FabZ

Iprscan [seg]

13

27

-

Iprscan [SSF54637]

3

93

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ByMVRWKv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits