Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3983trxANP_639322.1thioredoxin

trxA XCC3983
XCC3982
XCC3982
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3984
XCC3984
ID trxA
AC NP_639322.1
LT XCC3983
SY
OR NC_003902 from 4717583 to 4717909 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE thioredoxin
IP Thioredoxin-like fold; Thioredoxin domain;
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
PM
AN
SQ 108 aa
 
........10........20........30........40........50
| | | | |
MQTITVTSPEHYTEVLAAHPRALVDFYKDNCPGCKMLDMSLDKFSASDAA
AGVALLKVKLEVVGEEFFRDLGLRQTPTLALYRDGSEVARLPGFQSPAQV
ETAVKTSL
pubmed

1

105

S=141 I=30 E=2.14039e-09

Gp128

Pubmed 18567664

 

prodomImg

pubmed

1

97

S=139 I=31 E=3.45741e-09

Gp60

Pubmed 16188359

 

prodomImg

pubmed

3

98

S=109 I=28 E=1.34387e-05

Thioredoxin ; Electron transport Redox-active center

Pubmed 9795994

 

prodomImg

sp

3

98

S=109 I=28 E=8.98163e-06

Thioredoxin - Mycobacterium smegmatis

Pubmed 9795994,

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

3

105

Thioredoxin fold

Iprscan IPR015467 [PTHR10438]

12

108

Thioredoxin, core

Iprscan IPR013766 [PF00085]

2

107

Thioredoxin domain

Iprscan IPR017936 [PS51352]

1

108

Thioredoxin-like

Iprscan [seg]

49

66

-

Iprscan IPR012336 [SSF52833]

3

108

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 60BlPUdA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits