Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3777trxANP_639122.1thioredoxin

trxA XCC3777
XCC3776
XCC3776
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3778
XCC3778
ID trxA
AC NP_639122.1
LT XCC3777
SY
OR NC_003902 from 4489346 to 4489687 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE thioredoxin
IP Thioredoxin; Thioredoxin-like fold; Thioredoxin family; ;
CL
EC
GO Biological Process: glycerol ether metabolic process (GO:0006662)
Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 113 aa
 
........10........20........30........40........50
| | | | |
MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTY
QGKLKVAKVNVDQNRALAIKYHVRSIPMLLLFKDGEVQASQIGAVGKGQL
TQMIDKTLGGAAA
xansp

NP_637970.1 lcl|trx-XCC2622

1

104

S=240 I=45 E=2.92363e-23

thioredoxin

xansp

NP_636554.1 lcl|trx-XCC1180

8

100

S=215 I=42 E=3.15437e-20

thioredoxin

xansp

NP_635477.1 lcl|trxA-XCC0082

19

86

S=95 I=32 E=1.15295e-05

thioredoxin

pubmed

1

108

S=375 I=62 E=1.15088e-37

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 1561103,8253691

 

prodomImg

pubmed

1

108

S=375 I=62 E=1.15088e-37

Thioredoxin-1 ; Electron transport Host-virus interaction Redox-active center

Pubmed 6098320,6099324

 

prodomImg

pubmed

1

108

S=346 I=55 E=3.35493e-34

Thioredoxin ; Electron transport Redox-active center

Pubmed 7496529

 

prodomImg

pubmed

2

108

S=341 I=54 E=1.47703e-33

Thioredoxin

Pubmed 17294328

 

prodomImg

pubmed

1

108

S=341 I=56 E=1.51617e-33

Thioredoxin ; Electron transport Redox-active center

Pubmed 10224002

 

prodomImg

pubmed

2

107

S=318 I=52 E=7.59499e-31

Thioredoxin ; Electron transport Redox-active center

Pubmed 3567166

 

prodomImg

pubmed

7

104

S=318 I=57 E=8.00288e-31

Thioredoxin C-1 ; Electron transport Redox-active center

Pubmed 7021558

 

prodomImg

pubmed

4

109

S=310 I=53 E=7.07738e-30

Thioredoxin M-type, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 1536927,3510868

 

prodomImg

pubmed

1

108

S=309 I=47 E=1.16333e-29

Thioredoxin

Pubmed 11976137

 

prodomImg

pubmed

3

108

S=307 I=51 E=1.69248e-29

Thioredoxin M-type, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 8058831,8642611

 

prodomImg

sp

1

108

S=375 I=62 E=7.61473e-38

Thioredoxin-1 - Shigella flexneri

 

prodomImg

sp

1

108

S=375 I=62 E=7.61473e-38

Thioredoxin-1 - Salmonella typhimurium

Pubmed 1561103,8253691,

 

prodomImg

sp

1

108

S=375 I=62 E=7.61473e-38

Thioredoxin-1 - Salmonella typhi

 

prodomImg

sp

1

108

S=375 I=62 E=7.61473e-38

Thioredoxin-1 - Escherichia coli (strain K12)

Pubmed 6098320,6099324,3891733,1379743,4883076,1094461,4616096,2181145,8098620,10489448,10947986,2193685,7812718,

 

prodomImg

sp

1

108

S=375 I=62 E=7.61473e-38

Thioredoxin-1 - Escherichia coli O6

 

prodomImg

Iprscan IPR006662 [PR00421]

24

32

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

32

41

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

72

83

Thioredoxin-like subdomain

Iprscan IPR012335 [G3DSA:3.40.30.10]

2

111

Thioredoxin fold

Iprscan [PTHR10438:SF13]

14

108

-

Iprscan IPR015467 [PTHR10438]

14

108

Thioredoxin, core

Iprscan IPR013766 [PF00085]

4

107

Thioredoxin domain

Iprscan IPR005746 [TIGR01068]

8

108

Thioredoxin

Iprscan IPR017937 [PS00194]

25

43

Thioredoxin, conserved site

Iprscan IPR017936 [PS51352]

1

109

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

1

109

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nxURwq3w)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

384 hits
swiss-prot

Swiss-Prot ncbi-blastp

311 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits