Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3771rpoHNP_639116.1RNA polymerase factor sigma-32

rpoH XCC3771
XCC3770
XCC3770
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3772
XCC3772
ID rpoH
AC NP_639116.1
LT XCC3771
SY
OR NC_003902 from 4483068 to 4483943 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE RNA polymerase factor sigma-32
IP RNA polymerase sigma factor RpoH, proteobacteria; RNA polymerase sigma factor, regions 3 and 4; RNA polymerase sigma-E type; RNA polymerase sigma-70
CL
EC
GO Biological Process: response to heat (GO:0009408)
Biological Process: transcription initiation (GO:0006352)
DNA-dependent (GO:0006355)
Molecular Function: sigma factor activity (GO:0016987)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: DNA binding (GO:0003677)
PM
AN
SQ 291 aa
 
........10........20........30........40........50
| | | | |
MNQITSTALVANNLPIPSALGSLDAYIGAVHQIPVLSVDEEQNLARRFRD
ELDLDAARELVHSHLRFVVHVARGYNGYGLPLGDLIQEGNIGLMKAVKRF
DPEMGVRLVSFAVHWIRAEMHEFILKNWRIVKVATTKAQRKLFFNLRKSK
TRLGWLNASEVTAVAKDLNVSEREVMEMESRLSGRDIGFDASSDEDDDHG
PPSPVSYLVANEEDPSQAYERHDSEDNQLQLLREGMAGLDTRSRDIVKRR
WLDSESKVTLQELADEYGVSAERIRQIEANALKKMKALFVA
xansp

NP_639081.1 lcl|rpoD-XCC3736

56

286

S=239 I=30 E=1.74896e-22

RNA polymerase sigma factor RpoD

pubmed

1

291

S=1534 I=100 E=2.50489e-177

Heat shock sigma factor 32 (RNA polymerase sigma-32 factor) ; DNA-binding Stress response Transcription regulation

Pubmed 9535756

 

prodomImg

pubmed

6

291

S=866 I=60 E=2.07205e-96

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 11320135

 

prodomImg

pubmed

16

286

S=852 I=62 E=9.77319e-95

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 11430412

 

prodomImg

pubmed

11

290

S=849 I=57 E=2.31686e-94

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 16362517

 

prodomImg

pubmed

12

286

S=842 I=60 E=1.9445e-93

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 9168128

 

prodomImg

pubmed

6

289

S=841 I=59 E=2.35565e-93

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 10492171

 

prodomImg

pubmed

21

286

S=841 I=59 E=2.39709e-93

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 7501460

 

prodomImg

pubmed

18

287

S=830 I=60 E=5.67786e-92

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 2841288,6088062

 

prodomImg

pubmed

13

287

S=822 I=59 E=5.33724e-91

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 2664713

 

prodomImg

pubmed

21

286

S=806 I=56 E=4.75737e-89

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 9079916

 

prodomImg

sp

12

286

S=842 I=60 E=1.22551e-93

RNA polymerase sigma-32 factor - Vibrio cholerae

Pubmed 9168128,

 

prodomImg

sp

21

286

S=841 I=59 E=1.51075e-93

RNA polymerase sigma-32 factor - Proteus mirabilis

Pubmed 7501460,

 

prodomImg

sp

18

287

S=830 I=60 E=3.57845e-92

RNA polymerase sigma-32 factor - Escherichia coli (strain K12)

Pubmed 2841288,6088062,6387714,8041620,

 

prodomImg

sp

18

287

S=830 I=60 E=3.57845e-92

RNA polymerase sigma-32 factor - Escherichia coli O6

 

prodomImg

sp

18

287

S=830 I=60 E=3.57845e-92

RNA polymerase sigma-32 factor - Escherichia coli O157:H7

 

prodomImg

Iprscan IPR000943 [PR00046]

239

251

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

259

274

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

274

285

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

84

97

RNA polymerase sigma-70 factor

Iprscan IPR011991 [G3DSA:1.10.10.10]

221

286

Winged helix repressor DNA-binding

Iprscan [G3DSA:1.10.601.10]

25

129

-

Iprscan IPR007627 [PF04542]

60

130

RNA polymerase sigma-70 region 2

Iprscan IPR007630 [PF04545]

235

287

RNA polymerase sigma-70 region 4

Iprscan IPR012759 [TIGR02392]

21

291

RNA polymerase sigma factor RpoH, proteobacteria

Iprscan IPR014284 [TIGR02937]

55

289

RNA polymerase sigma-70

Iprscan IPR000943 [PS00715]

84

97

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PS00716]

259

285

RNA polymerase sigma-70 factor

Iprscan IPR013324 [SSF88659]

197

289

RNA polymerase sigma factor, regions 3 and 4

Iprscan IPR013325 [SSF88946]

16

130

RNA polymerase sigma factor, region 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QcnthGsv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

323 hits
swiss-prot

Swiss-Prot ncbi-blastp

126 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits