Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3761sppANP_639106.1protease IV

sppA XCC3761
XCC3760
XCC3760
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3762
XCC3762
ID sppA
AC NP_639106.1
LT XCC3761
SY
OR NC_003902 from 4470120 to 4472021 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE protease IV
IP Peptidase S49, protease IV; Peptidase S49, SppA
CL
EC
GO Biological Process: signal peptide processing (GO:0006465)
Biological Process: proteolysis (GO:0006508)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: peptidase activity (GO:0008233)
PM
AN
SQ 633 aa
 
........10........20........30........40........50
| | | | |
MNHPVRRNPIATFFVGLWDVMNFTRRLIFNLVFFGFLFLLLLLFVVAIAR
GDGTKPLAARTTLVIAPEGTLVEQFSADPVSRSLAKAVGDKSAEEVQLRD
LVRVIEAAGKDSKIERVLLNLDKLQPSGFASQREVAKALQGLRASGKQIV
AFSESMSQGQYLLAAQANEVYLDPMGSVLLEGLGRYRQYFREGLQDKLGV
DVHLFRVGEYKSAAEPYILDAASADAKEADLFWMNDVWQRYLADVATARK
LSPAQLAAGIDTLPEGVTAAGGDLAKFALQQKLVDGLKTREQVDSLLTER
GVADNDADGGFRSIDFGSYLTQLQAQHSPMDSRPQVAVVVAAGEISGGEQ
PAGRIGGESTAALLRQARDDEEIKAVVLRVDSPGGEVFASEQIRREVVAL
KQAGKPVVVSMGDLAASGGYWISMNADRIYADPSTISGSIGIFGMVPNLT
RALDKIGVHTDGVGTTRFAGAFDITRPLDPAAGQVIQAVINKGYADFTGK
VAQARHQSVEAIDKVARGRVWSGAQAKDHGLVDAFGGMQEAVADAASRAK
LSKGKFRVRYVEKAATPFSQFMSGFAGSRLGAWMLSDSGMARALLARSLP
EVDTQLRFVEDAVHDSKAGGTPVKALAYCFCGF
pubmed

10

631

S=996 I=40 E=9.84083e-112

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 3522590

 

prodomImg

pubmed

83

545

S=817 I=39 E=5.62717e-90

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 10675023

 

prodomImg

pubmed

364

536

S=319 I=35 E=9.76783e-30

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

Pubmed 9387221

 

prodomImg

pubmed

364

583

S=289 I=33 E=5.01849e-26

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

Pubmed 10103244

 

prodomImg

pubmed

405

583

S=256 I=32 E=4.54434e-22

Putative peptidase pfaP EC=3.4.21.- ; Hydrolase Protease Signal

Pubmed 7628708

 

prodomImg

pubmed

335

581

S=246 I=31 E=6.9606e-21

Putative protease

Pubmed 11425734

 

prodomImg

pubmed

334

551

S=245 I=30 E=1.09533e-20

Peptidase ; Plasmid

Pubmed 18070959

 

prodomImg

pubmed

358

552

S=225 I=30 E=3.14041e-18

PspA

Pubmed 8793884

 

prodomImg

pubmed

334

441

S=216 I=44 E=2.97786e-17

Probe 6 protein

Pubmed 11805055

 

prodomImg

pubmed

496

553

S=117 I=40 E=3.38951e-05

Probe 6 protein

Pubmed 11805055

 

prodomImg

sp

10

631

S=996 I=40 E=6.23864e-112

Protease 4 - Escherichia coli (strain K12)

Pubmed 3522590,7973728,

 

prodomImg

sp

83

545

S=817 I=39 E=3.56737e-90

Protease 4 - Haemophilus influenzae

Pubmed 10675023,

 

prodomImg

sp

83

559

S=703 I=37 E=2.14506e-76

Protease 4 homolog - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

364

536

S=319 I=35 E=6.19236e-30

Putative signal peptide peptidase sppA - Bacillus subtilis

Pubmed 9387221,10455123,

 

prodomImg

sp

352

574

S=300 I=34 E=1.29713e-27

Putative protease slr0021 - Synechocystis sp. (strain PCC 6803)

 

prodomImg

Iprscan [PD002897]

161

217

-

Iprscan [PD002897]

405

487

-

Iprscan IPR004634 [PIRSF001217]

1

633

Peptidase S49, protease IV

Iprscan IPR002142 [PF01343]

141

256

Peptidase S49

Iprscan IPR002142 [PF01343]

399

552

Peptidase S49

Iprscan IPR004634 [TIGR00705]

18

609

Peptidase S49, protease IV

Iprscan IPR004635 [TIGR00706]

335

550

Peptidase S49, SppA

Iprscan [seg]

27

46

-

Iprscan [SignalP-NN(euk)]

1

51

-

Iprscan [SignalP-NN(euk)]

1

51

-

Iprscan [tmhmm]

27

49

-

Iprscan [tmhmm]

27

49

-

Iprscan [SSF52096]

321

540

-

Iprscan [SSF52096]

71

292

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9SNv0zmf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits