Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3736rpoDNP_639081.1RNA polymerase sigma factor RpoD

rpoD XCC3736
XCC3735
XCC3735
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3737
XCC3737
ID rpoD
AC NP_639081.1
LT XCC3736
SY
OR NC_003902 from 4442015 to 4443889 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE RNA polymerase sigma factor RpoD
IP RNA polymerase sigma factor 70, region 1.1; RNA polymerase sigma factor RpoD, C-terminal; RNA polymerase sigma factor, regions 3 and 4; RNA polymerase sigma-K type; RNA polymerase sigma-70
CL
EC
GO Biological Process: regulation of transcription (GO:0045449)
Biological Process: transcription initiation (GO:0006352)
DNA-dependent (GO:0006355)
Molecular Function: transcription regulator activity (GO:0030528)
Molecular Function: sigma factor activity (GO:0016987)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: DNA binding (GO:0003677)
PM
AN
SQ 624 aa
 
........10........20........30........40........50
| | | | |
MANERPAQQSDIKLLISKGLEQGYLTYAEVNDHLPDDLVDPEQIEDIISM
INGMGIDVHEVAPDAETLLLNDGNTGNREVDDTAAEEAAAALTALDTEGG
RTTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSQVQAALGTFPLSTE
LLLSDYEAHKEGKKRLAEIVVGFNDLIEEADAAAAALAAAGPVAVDEDAV
DEDADEDGDDDAAEEEAGPTGPDPVEVATRMENLANEYAKFKKAYVKYGA
EHKNVAKAREDMAAIFTTLKLPLPLTDALVTQLRGVVNGIKDHERKVLHL
ATTVARMPRKDFIRSWEGNQTNLEWVEDALKRKQKWSSALRDVKDQIVSE
QQGSIEMEKANYLTLAEIKDISRAMAYGEAKARKAKKEMVEANLRLVISI
AKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAIT
RSIADQARTIRIPVHMIETINKLNRISRQMLQQFGREATPEELAKEMDMP
EDKIRKVMKIAKEPISMETPIGDDEDSHLGDFIEDTNVESPIDNTTNINL
SETVRDVLAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQI
EAKALRKLRHPSRSEQLRSFLDID
xansp

NP_639116.1 lcl|rpoH-XCC3771

385

609

S=239 I=30 E=4.36651e-22

RNA polymerase factor sigma-32

xansp

NP_637271.1 lcl|fliA-XCC1906

380

609

S=108 I=28 E=2.66731e-06

RNA polymerase sigma factor

pubmed

242

624

S=1978 I=98 E=0

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 9126341

 

prodomImg

pubmed

1

147

S=663 I=87 E=2.08289e-71

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 9126341

 

prodomImg

pubmed

8

622

S=1778 I=59 E=0

RNA polymerase sigma factor ; DNA-binding DNA-directed Transcription regulation

Pubmed 9434175

 

prodomImg

pubmed

8

622

S=1748 I=59 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 7665535

 

prodomImg

pubmed

248

622

S=1400 I=71 E=1.06e-160

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 1902749

 

prodomImg

pubmed

8

175

S=439 I=55 E=3.37668e-44

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 1902749

 

prodomImg

pubmed

257

622

S=1363 I=72 E=3.48823e-156

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 8566819

 

prodomImg

pubmed

8

175

S=430 I=55 E=4.19556e-43

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 8566819

 

prodomImg

pubmed

230

622

S=1349 I=66 E=1.65969e-154

RNA polymerase sigma-70 subunit ; DNA-binding factor Transcription regulation

Pubmed 15262936

 

prodomImg

pubmed

9

175

S=461 I=55 E=7.16503e-47

RNA polymerase sigma-70 subunit ; DNA-binding factor Transcription regulation

Pubmed 15262936

 

prodomImg

sp

1

624

S=2833 I=88 E=0

RNA polymerase sigma factor rpoD - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

624

S=2558 I=79 E=0

RNA polymerase sigma factor rpoD - Xylella fastidiosa

 

prodomImg

sp

1

624

S=2553 I=79 E=0

RNA polymerase sigma factor rpoD - Xylella fastidiosa (strain Temecula1 / ATCC 700964)

 

prodomImg

sp

8

622

S=1748 I=59 E=0

RNA polymerase sigma factor rpoD - Pseudomonas fluorescens

Pubmed 7665535,

 

prodomImg

sp

12

622

S=1552 I=53 E=2.5078e-179

RNA polymerase sigma factor rpoD - Haemophilus influenzae

 

prodomImg

Iprscan [coil]

326

347

-

Iprscan [coil]

583

604

-

Iprscan IPR000943 [PR00046]

413

426

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

437

445

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

561

573

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

582

597

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

597

608

RNA polymerase sigma-70 factor

Iprscan IPR011991 [G3DSA:1.10.10.10]

462

513

Winged helix repressor DNA-binding

Iprscan IPR011991 [G3DSA:1.10.10.10]

543

621

Winged helix repressor DNA-binding

Iprscan [G3DSA:1.10.601.10]

118

458

-

Iprscan IPR009042 [PF00140]

103

139

RNA polymerase sigma-70 region 1.2

Iprscan IPR007127 [PF03979]

4

89

RNA polymerase sigma factor 70, region 1.1

Iprscan IPR007624 [PF04539]

463

545

RNA polymerase sigma-70 region 3

Iprscan IPR007627 [PF04542]

389

459

RNA polymerase sigma-70 region 2

Iprscan IPR007630 [PF04545]

557

610

RNA polymerase sigma-70 region 4

Iprscan IPR007631 [PF04546]

145

358

RNA polymerase sigma factor 70, non-essential region

Iprscan IPR012760 [TIGR02393]

385

622

RNA polymerase sigma factor RpoD, C-terminal

Iprscan IPR014284 [TIGR02937]

384

612

RNA polymerase sigma-70

Iprscan IPR000943 [PS00715]

413

426

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PS00716]

582

608

RNA polymerase sigma-70 factor

Iprscan [seg]

180

224

-

Iprscan [seg]

81

98

-

Iprscan IPR013324 [SSF88659]

462

536

RNA polymerase sigma factor, regions 3 and 4

Iprscan IPR013324 [SSF88659]

519

623

RNA polymerase sigma factor, regions 3 and 4

Iprscan IPR013325 [SSF88946]

121

456

RNA polymerase sigma factor, region 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KlJs6Nm1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

724 hits
swiss-prot

Swiss-Prot ncbi-blastp

167 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

25 hits