Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3625aceENP_638971.1pyruvate dehydrogenase subunit E1

aceE XCC3625
XCC3624
XCC3624
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3626
XCC3626
ID aceE
AC NP_638971.1
LT XCC3625
SY
OR NC_003902 from 4321483 to 4324170 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE pyruvate dehydrogenase subunit E1
IP 2-oxo-acid dehydrogenase E1 component homodimeric type; Transketolase, N-terminal; Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 895 aa
 
........10........20........30........40........50
| | | | |
MNWLNEVLHNDPNPLETQEWLESIKAVIDVEGPERAHQLLEGMVEQTRRA
GAYLPFSPTTEYVNTISPANEAKNPGDSALEWKIRSIIRWNAMATVVRAN
RKPGDLGGHIASFASSATLYDVGFNHFWRAPSDQHPGDLLFIQGHSAPGI
YARAFLEGRINEAQLDNFRMEVDGQGISSYPHPWLMPEFWQTPTVSMGLG
PLAAIYQAQFMRYLENRGLIEKSDRKVWCFIGDGESDEPETLGAIALAGR
EGLDNLIFVVNCNLQRLDGPVRGNGKIIQELEGVFRGGGWNVIKLLWGGY
WDALLAKDTDGVLRKLMMETVDGEYQNCKAFGGAYTRANFFGKYPETAAM
VAGLSDDDIWRLNRGGHDPHKVYAAYNQAVNTKGMPTVILAKTVKGYGMG
SAGEALNPTHQTKKLDDAAVKHFRDRFNIPVTDAQLEDGKVPFYHPGEDS
PEVQYLKERRNVLGGFLPSRRPKASKSFVAPTLDKFERLLKDSGERSYST
TMSFVQSLNIALRDKELGPRIVPIVADEARTFGMEGMFRQIGIYAPFGQK
YKPVDADQLMYYREDQTGQVLQQGISEPGAIASWMAAGTSYSVSDVPMLP
FYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAGRTTLNGEGLQHEDGF
SQVIAGSIPNVRSYDPTFGFEVTVIMQHGMKAMMEDQIDEYYYITLMNEN
YAHPGMPDGAQEGIIKGMYLLKDAGKPKKGELRVQLLGSGTILREAIAAA
ELLDKDFGVTADIWSCPSFNELRRDGFDAERWNRLHPEAEQRKPYVTQLL
EGRQGPAIAATDYVRLFADQIRAFVPMTYSVLGTDGFGRSDTRANLRRFF
EVDRYYIAHAAIAALAKDGKMTGKDVSRAIKQYKIDPEKANPVGV
pubmed

10

893

S=2982 I=62 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

Pubmed 9171401

 

prodomImg

pubmed

4

892

S=2959 I=61 E=0

Dihydrolipoamide acyltransferase

Pubmed 17526788

 

prodomImg

pubmed

10

895

S=2890 I=61 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

Pubmed 8021225

 

prodomImg

pubmed

4

892

S=2659 I=56 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

Pubmed 6343085,8202364

 

prodomImg

pubmed

11

892

S=2441 I=53 E=0

Pyruvate dehydrogenase (E1) EC=1.2.4.1 ; Oxidoreductase

Pubmed 8647112

 

prodomImg

pubmed

11

883

S=2289 I=52 E=0

Alpha-ketobutyrate dehydrogenase E1

Pubmed 8586629,9190812

 

prodomImg

pubmed

10

886

S=2141 I=49 E=0

Pyruvate dehydrogenase

Pubmed 17600063

 

prodomImg

pubmed

11

885

S=2098 I=49 E=0

Pyruvate dehydrogenase component

Pubmed 9858775

 

prodomImg

pubmed

10

438

S=1532 I=65 E=1.64203e-176

Dehydrogenase (E1) component of pyruvate dehydrogenase complex

Pubmed 16796688

 

prodomImg

pubmed

145

287

S=567 I=70 E=1.61074e-59

Putative uncharacterized protein

Pubmed 17124322

 

prodomImg

sp

10

893

S=2982 I=62 E=0

Pyruvate dehydrogenase E1 component - Pseudomonas aeruginosa

Pubmed 9171401,

 

prodomImg

sp

10

895

S=2890 I=61 E=0

Pyruvate dehydrogenase E1 component - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Pubmed 8021225,

 

prodomImg

sp

4

892

S=2659 I=56 E=0

Pyruvate dehydrogenase E1 component - Escherichia coli (strain K12)

Pubmed 6343085,8202364,8262214,11955070,

 

prodomImg

sp

4

892

S=2659 I=56 E=0

Pyruvate dehydrogenase E1 component - Escherichia coli O157:H7

 

prodomImg

sp

4

893

S=2609 I=55 E=0

Pyruvate dehydrogenase E1 component - Haemophilus influenzae

 

prodomImg

Iprscan IPR015941 [G3DSA:3.40.50.920]

716

895

Transketolase C-terminal-like

Iprscan [G3DSA:3.40.50.970]

74

479

-

Iprscan IPR004660 [PIRSF000156]

1

895

2-oxo-acid dehydrogenase E1 component homodimeric type

Iprscan [PTHR11624]

112

293

-

Iprscan [PTHR11624:SF2]

112

293

-

Iprscan IPR005474 [PF00456]

365

398

Transketolase, N-terminal

Iprscan IPR004660 [TIGR00759]

7

895

2-oxo-acid dehydrogenase E1 component homodimeric type

Iprscan [seg]

742

753

-

Iprscan [seg]

857

866

-

Iprscan [SSF52518]

476

705

-

Iprscan [SSF52518]

59

475

-

Iprscan IPR009014 [SSF52922]

706

895

Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one P2I929mL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

41 hits
swiss-prot

Swiss-Prot ncbi-blastp

21 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits