Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3403betBNP_638749.1betaine aldehyde dehydrogenase

betB XCC3403
XCC3402
XCC3402
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3404
XCC3404
ID betB
AC NP_638749.1
LT XCC3403
SY
OR NC_003902 from 4047475 to 4048947 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE betaine aldehyde dehydrogenase
IP Betaine aldehyde dehydrogenase; ; ;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: betaine biosynthetic process (GO:0006578)
Molecular Function: betaine-aldehyde dehydrogenase activity (GO:0008802)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 490 aa
 
........10........20........30........40........50
| | | | |
MPRFPDQLLYIGGRYVPARGGHTFEVVNPATGEVLANVHNADADDLDAAV
DSAKAGQRHWAALTVVERSRILLRAVALLRERNDALAELETLNTGKPLSE
TRSVDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHEPLGVVGAIG
AWNYPIQIALWKAAPALAAGNAMIFKPSEVTPLTALKLAEIFTEAGLPDG
VFNVLPGDGASVGHALTEHPEIEKISFTGGTATGRKVMASASSSSLKDVT
MELGGKSPLIVCADADLDLAADIAMMANFYSSGQVCTNGTRVFVPRALRT
AFEARLLARVQRIHIGDPLDERTTFGPMVSAAHMQRVLEHIEQGKAEGAR
LLFGGERLRDGALAQGCYVAPTIFSDCTDVMTIVREEIFGPVLSLLTYDD
EDEAITRANATSYGLAAGVVTPDLSRAHRLIHRLEAGICWINTWGESPAP
MPVGGYKQSGVGRENGLATLQAYTRTKSVQVELERYASVF
Hamap BETB_MF_00804 raw_score=17678 norm_score=56.615

Betaine aldehyde dehydrogenase [betB].

xansp

NP_635496.1 lcl|aldA-XCC0101

2

481

S=763 I=37 E=1.02441e-85

chloroacetaldehyde dehydrogenase

xansp

NP_635749.1 lcl|xylC-XCC0354

13

466

S=500 I=30 E=7.35091e-54

benzaldehyde dehydrogenase II

xansp

NP_637690.1 lcl|gabD-XCC2336

23

481

S=473 I=29 E=1.30365e-50

succinate-semialdehyde dehydrogenase

xansp

NP_636634.1 lcl|mmsA-XCC1260

5

479

S=433 I=30 E=1.05311e-45

methylmalonate-semialdehyde dehydrogenase

xansp

NP_637157.1 lcl|XCC1791

10

478

S=413 I=28 E=2.40694e-43

aldehyde dehydrogenase

xansp

NP_639180.1 lcl|putA-XCC3835

60

466

S=376 I=29 E=8.41921e-39

bifunctional proline dehydrogenase/pyrroline-5- carboxylate dehydrogenase

xansp

NP_636200.1 lcl|badH-XCC0809

9

356

S=326 I=31 E=8.67444e-33

aldehyde dehydrogenase

xansp

NP_636199.1 lcl|XCC0808

373

479

S=163 I=40 E=4.8826e-13

hypothetical protein

pubmed

1

490

S=1623 I=62 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase Stress response

Pubmed 1956285,1879697

 

prodomImg

pubmed

7

490

S=1565 I=62 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 10708384

 

prodomImg

pubmed

5

481

S=1151 I=51 E=1.46495e-130

Betaine aldehyde dehydrogenase 1 EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 9141699

 

prodomImg

pubmed

10

484

S=1092 I=48 E=1.6599e-123

Betaine aldehyde dehydrogenase 2 EC=1.2.1.8 ; NAD Oxidoreductase Plasmid

Pubmed 11481432

 

prodomImg

pubmed

8

490

S=1068 I=45 E=1.54419e-120

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 EC=1.2.1.19 ; Acetylation Cytoplasm NAD Oxidoreductase Polymorphism

Pubmed 8786138,10702312

 

prodomImg

pubmed

8

490

S=1065 I=45 E=3.38444e-120

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 ; Acetylation Cytoplasm NAD Oxidoreductase

Pubmed 10702312

 

prodomImg

pubmed

6

490

S=1046 I=44 E=7.34109e-118

Betaine aldehyde dehydrogenase EC=1.2.1.8 EC=1.2.1.3 ; Cytoplasm NAD Oxidoreductase

Pubmed 9792097

 

prodomImg

pubmed

8

490

S=1042 I=44 E=1.91547e-117

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 ; Acetylation Cytoplasm NAD Oxidoreductase

Pubmed 10702312

 

prodomImg

pubmed

6

482

S=1032 I=45 E=3.43249e-116

Aldehyde dehydrogenase family 9 member A1 EC=1.2.1.3 ; Cytoplasm NAD Oxidoreductase

Pubmed 17236798

 

prodomImg

pubmed

9

484

S=893 I=38 E=2.47246e-99

4-hydroxymuconic semialdehyde dehydrogenase EC=1.2.1.61 ; Oxidoreductase

Pubmed 11322873,18502868

 

prodomImg

sp

1

490

S=2277 I=90 E=0

Betaine aldehyde dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

490

S=2210 I=87 E=0

Betaine aldehyde dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

490

S=2194 I=86 E=0

Betaine aldehyde dehydrogenase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

490

S=1749 I=68 E=0

Betaine aldehyde dehydrogenase - Pseudomonas stutzeri (strain A1501)

 

prodomImg

sp

1

490

S=1749 I=69 E=0

Betaine aldehyde dehydrogenase - Pseudomonas mendocina (strain ymp)

 

prodomImg

Iprscan IPR016162 [G3DSA:3.40.605.10]

9

294

Aldehyde dehydrogenase, N-terminal

Iprscan IPR015590 [PTHR11699]

51

483

Aldehyde dehydrogenase

Iprscan [PTHR11699:SF47]

51

483

-

Iprscan IPR015590 [PF00171]

15

479

Aldehyde dehydrogenase

Iprscan IPR011264 [TIGR01804]

10

477

Betaine aldehyde dehydrogenase

Iprscan IPR016160 [PS00070]

279

290

Aldehyde dehydrogenase, conserved site

Iprscan IPR016160 [PS00687]

251

258

Aldehyde dehydrogenase, conserved site

Iprscan IPR016161 [SSF53720]

9

482

Aldehyde/histidinol dehydrogenase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one f10kGSwg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

488 hits
swiss-prot

Swiss-Prot ncbi-blastp

479 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

9 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits