Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3389NP_638735.1alcohol dehydrogenase C

XCC3389
XCC3388
XCC3388
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3390
XCC3390
ID
AC NP_638735.1
LT XCC3389
SY
OR NC_003902 from 4031369 to 4032478 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE alcohol dehydrogenase C
IP Alcohol dehydrogenase superfamily, zinc-containing;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
PM
AN
SQ 369 aa
 
........10........20........30........40........50
| | | | |
MKSRAAVAFGPGKPLEIVEIDVAPPQAGEVLVRITHTGVCHTDAFTLSGD
DPEGIFPSVLGHEGGGIVEQIGEGVTGVKVGDHVIPLYTAECRKCKFCLS
GKTNLCQAVRATQGKGLMPDGTTRFSYNGEPIFHYMGCSTFSEYTVVPEI
SLAVVNPEAPLEKVCLLGCGVTTGIGAVHNTAKVKPGESVAVFGLGGIGL
AVIQGAVQAKAGRILAIDTNPGKFDLARSMGATDCINPKDYDKPIQEVIV
ELTDGGVDFSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGQEISTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEQSMKGEIDLDPFITHTMPLEQI
NEAFDLMHEGKSIRTVIHF
xansp

NP_638821.1 lcl|adhC-XCC3475

1

369

S=1233 I=61 E=7.46953e-143

alcohol dehydrogenase class III

xansp

NP_639049.1 lcl|ybdR-XCC3703

29

275

S=157 I=28 E=1.94133e-12

Zn-dependent alcohol dehydrogenase

xansp

NP_636331.1 lcl|tdh-XCC0945

4

369

S=156 I=23 E=2.39318e-12

L-threonine 3-dehydrogenase

xansp

NP_638078.1 lcl|XCC2730

162

369

S=154 I=30 E=4.60217e-12

alcohol dehydrogenase

xansp

NP_635424.1 lcl|yahK-XCC0029

2

367

S=125 I=27 E=1.32993e-08

alcohol dehydrogenase

xansp

NP_637361.1 lcl|fdh-XCC1996

79

265

S=116 I=27 E=1.56823e-07

glutathione-dependent formaldehyde dehydrogenase

pubmed

1

369

S=1578 I=80 E=0

Formaldehyde dehydrogenase (Glutathione) EC=1.2.1.1 ; Metal-binding Oxidoreductase Zinc

Pubmed 8891129

 

prodomImg

pubmed

1

369

S=1557 I=78 E=5.82339e-180

Glutathione-dependent formaldehyde dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 11577159

 

prodomImg

pubmed

1

369

S=1544 I=77 E=2.30718e-178

Putative alcohol dehydrogenase class III ; Plasmid

Pubmed 18070959

 

prodomImg

pubmed

1

369

S=1543 I=77 E=2.67579e-178

Putative alcohol dehydrogenase class III ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 18070959

 

prodomImg

pubmed

1

369

S=1521 I=76 E=1.28321e-175

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Plasmid Zinc

Pubmed 8052160

 

prodomImg

pubmed

1

369

S=1445 I=73 E=2.28417e-166

Putative formaldehyde dehydrogenase (Glutathione-dependent) ; Metal-binding Oxidoreductase Zinc

Pubmed 9098058,10591845

 

prodomImg

pubmed

22

369

S=1395 I=74 E=2.15692e-160

HI0185-like protein ; Metal-binding Oxidoreductase Zinc

Pubmed 16714566

 

prodomImg

pubmed

1

369

S=1253 I=62 E=3.91493e-143

Alcohol dehydrogenase class-3 chain L EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Acetylation Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8931553,7607314

 

prodomImg

pubmed

1

369

S=1252 I=63 E=5.89779e-143

Alcohol dehydrogenase class-3 EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8863743

 

prodomImg

pubmed

1

369

S=1239 I=62 E=2.0502e-141

Alcohol dehydrogenase class-3 chain H EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Acetylation Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8931553,7607314

 

prodomImg

sp

1

369

S=1555 I=79 E=6.24265e-180

S-(hydroxymethyl)glutathione dehydrogenase - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

1

369

S=1553 I=77 E=1.25398e-179

S-(hydroxymethyl)glutathione dehydrogenase - Shigella sonnei (strain Ss046)

 

prodomImg

sp

1

369

S=1553 I=77 E=1.25398e-179

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

 

prodomImg

sp

1

369

S=1553 I=77 E=1.25398e-179

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli O9:H4 (strain HS)

 

prodomImg

sp

1

369

S=1553 I=77 E=1.25398e-179

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli O157:H7

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

1

369

-

Iprscan IPR002085 [PTHR11695]

4

220

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF4]

4

220

-

Iprscan IPR013149 [PF00107]

186

328

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

27

155

Alcohol dehydrogenase GroES-like

Iprscan IPR014183 [TIGR02818]

2

369

Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase

Iprscan IPR002328 [PS00059]

61

75

Alcohol dehydrogenase, zinc-containing, conserved site

Iprscan [seg]

61

78

-

Iprscan IPR011032 [SSF50129]

1

190

GroES-like

Iprscan IPR011032 [SSF50129]

317

369

GroES-like

Iprscan IPR016040 [SSF51735]

170

319

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8GsDbEBo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

956 hits
swiss-prot

Swiss-Prot ncbi-blastp

315 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits