Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC3274az1NP_638620.1electron transfer protein azurin I

az1 XCC3274
XCC3273
XCC3273
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC3275
XCC3275
ID az1
AC NP_638620.1
LT XCC3274
SY
OR NC_003902 from 3888072 to 3888521 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE electron transfer protein azurin I
IP Cupredoxin; Azurin, proteobacteria
CL
EC
GO Molecular Function: copper ion binding (GO:0005507)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 149 aa
 
........10........20........30........40........50
| | | | |
MKLLSTIAVLALVSLAPSAWAKTCAVTITGTDQMKFDQSAITIAPDCTEV
AVTLKHSGKLAATVMGHNWVLTKSDDFQAVANAGVRSTIADSYLPKADPR
VIAHTKVIGAGETATVTFPTSKLSKGGAYTFFCSFPGHWAMMKGTLRFG
pubmed

24

148

S=404 I=58 E=6.56265e-41

Azurin ; Signal

Pubmed 11440141

 

prodomImg

pubmed

24

148

S=400 I=56 E=1.98594e-40

Azurin I ; Signal

Pubmed 16832626

 

prodomImg

pubmed

24

148

S=392 I=55 E=1.94998e-39

Azurin-1 ; Copper Electron transport Metal-binding Periplasm

Pubmed 9761902

 

prodomImg

pubmed

24

148

S=370 I=53 E=8.79771e-37

Azurin ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 2116366,6842609

 

prodomImg

pubmed

24

149

S=359 I=50 E=1.87687e-35

Azurin ; Copper Electron transport Metal-binding Periplasm

Pubmed 6274637,6960351

 

prodomImg

pubmed

24

146

S=357 I=53 E=3.19455e-35

Azurin ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 2537198,2116366

 

prodomImg

pubmed

24

149

S=356 I=51 E=4.41073e-35

Azurin-2 ; Copper Electron transport Metal-binding Periplasm

Pubmed 7640272,15299774

 

prodomImg

pubmed

24

146

S=347 I=54 E=4.89312e-34

Azurin ; Copper Electron transport Metal-binding Periplasm

Pubmed 15299879

 

prodomImg

pubmed

24

146

S=344 I=54 E=1.36897e-33

Azurin ; Signal

Pubmed 11515547

 

prodomImg

pubmed

24

146

S=343 I=51 E=1.62976e-33

Azurin

Pubmed 12730177

 

prodomImg

sp

24

148

S=401 I=56 E=1.12612e-40

Azurin - Alcaligenes sp.

 

prodomImg

sp

24

148

S=398 I=56 E=2.6007e-40

Azurin precursor - Bordetella pertussis

 

prodomImg

sp

24

148

S=398 I=56 E=2.6007e-40

Azurin precursor - Bordetella parapertussis

 

prodomImg

sp

24

148

S=398 I=56 E=2.6007e-40

Azurin precursor - Bordetella bronchiseptica (Alcaligenes bronchisepticus)

 

prodomImg

sp

24

148

S=392 I=55 E=1.24929e-39

Azurin-1 - Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)

Pubmed 9761902,

 

prodomImg

Iprscan [PD003655]

24

149

-

Iprscan IPR008972 [G3DSA:2.60.40.420]

22

149

Cupredoxin

Iprscan IPR000923 [PF00127]

22

149

Blue (type 1) copper domain

Iprscan IPR014068 [TIGR02695]

24

148

Azurin, proteobacteria

Iprscan IPR000923 [PS00196]

126

142

Blue (type 1) copper domain

Iprscan [seg]

8

21

-

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan IPR008972 [SSF49503]

22

149

Cupredoxin

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JEgqDkzS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits