Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2809ptsINP_638157.1phosphotransferase system enzyme I

ptsI XCC2809
XCC2808
XCC2808
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2810
XCC2810
ID ptsI
AC NP_638157.1
LT XCC2809
SY
OR NC_003902 from 3313229 to 3314959 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE phosphotransferase system enzyme I
IP PEP-utilizing enzyme; Phosphoenolpyruvate-protein phosphotransferase; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL
EC
GO Biological Process: phosphorylation (GO:0016310)
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
Molecular Function: catalytic activity (GO:0003824)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 576 aa
 
........10........20........30........40........50
| | | | |
MSLRLRGHAASRGNALGRARVRQSHTLEVAEQRVPANQVETQLQRLHAAI
AAARTEMQQLRDRLHGALAREVGEFLELHALLLDDPELLQGLDDLIRTHR
YSADYALRVQRDRLAAVFDGMEDAYLRSRMDDLDHVIGRIHAFLHKRAPD
LKGVAGEILVCDNVAPSELAQLQAQGVVGIVTTAGSALSHSAILARSLHL
PLVVGVADAVQRVNDGDVLIVDAGSGQVIVDPTPEHLRDYRERLRTLAKE
QRELGRLRSKPTRTRDNVDITLLANAESLEDVAKAHALGASGLGLYRTEF
LFLQRNELPDEDEQFHTYRDTVLGMSGRPVTIRTLDLGADKADRTGLTLS
DEDNPALGLRGVRLSLARPAVAQAQLRAILRASGYGPVRILVPMVSGREE
ILLVRKQLKKLTAQLRDEGHEIAEHIPLGAMIEVPAAALALDCFIDDIDF
LSIGTNDLVQYLLAVDRNNEALGELYSPLHPAVLRLIAQVIATGRAHNKP
VAVCGEIAGDPRFVAMLLALGLTEFSLHPATLLEVRRAVRDLHLGQLRVH
GEKLLRARDRKSIEKWLASVAQGLLH
xansp

NP_637724.1 lcl|fruB-XCC2370

158

563

S=633 I=39 E=6.64286e-70

multiphosphoryl transfer protein

xansp

NP_637522.1 lcl|ppsA-XCC2166

155

534

S=242 I=28 E=1.62355e-22

phosphoenolpyruvate synthase

pubmed

5

574

S=986 I=37 E=1.73011e-110

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Cytoplasm Magnesium Metal-binding Phosphotransferase Sugar trans

Pubmed 15670601

 

prodomImg

pubmed

1

539

S=945 I=42 E=1.49857e-105

Putative phosphoenolpyruvate-protein phosphotransferase ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 18328084

 

prodomImg

pubmed

1

559

S=941 I=42 E=4.34141e-105

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1653223

 

prodomImg

pubmed

5

542

S=927 I=39 E=1.94333e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

1

547

S=899 I=36 E=5.01404e-100

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 9726852

 

prodomImg

pubmed

1

547

S=898 I=36 E=6.74417e-100

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 15590099

 

prodomImg

pubmed

1

555

S=896 I=36 E=1.20955e-99

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12610726

 

prodomImg

pubmed

9

565

S=892 I=37 E=3.95904e-99

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12855720

 

prodomImg

pubmed

5

555

S=891 I=35 E=4.59156e-99

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 2457575,2960675

 

prodomImg

pubmed

5

555

S=888 I=35 E=1.07904e-98

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1655788

 

prodomImg

sp

1

565

S=967 I=35 E=1.90096e-108

Phosphoenolpyruvate-protein phosphotransferase - Bacillus halodurans

 

prodomImg

sp

1

559

S=941 I=42 E=2.73475e-105

Phosphoenolpyruvate-protein phosphotransferase - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Pubmed 1653223,

 

prodomImg

sp

5

542

S=927 I=39 E=1.22415e-103

Phosphoenolpyruvate-protein phosphotransferase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 7670643,

 

prodomImg

sp

5

542

S=924 I=38 E=2.7541e-103

Phosphoenolpyruvate-protein phosphotransferase - Bacillus sp. (strain S)

 

prodomImg

sp

5

556

S=918 I=36 E=1.46889e-102

Phosphoenolpyruvate-protein phosphotransferase - Haemophilus influenzae

 

prodomImg

Iprscan [PD000940]

342

529

-

Iprscan IPR006318 [PR01736]

294

313

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

449

464

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

466

481

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

502

514

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

24

144

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

251

575

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan [PTHR22931]

3

568

-

Iprscan [PTHR22931:SF10]

3

568

-

Iprscan IPR008279 [PF00391]

147

226

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PF02896]

251

544

PEP-utilizing enzyme

Iprscan IPR008731 [PF05524]

5

130

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR006318 [TIGR01417]

5

568

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR000121 [PS00742]

449

467

PEP-utilizing enzyme

Iprscan IPR008731 [SSF47831]

25

147

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [SSF51621]

246

547

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

128

250

PEP-utilising enzyme, mobile region

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ROJeJy1M)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

83 hits
swiss-prot

Swiss-Prot ncbi-blastp

84 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits