Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2730NP_638078.1alcohol dehydrogenase

XCC2730
XCC2729
XCC2729
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2731
XCC2731
ID
AC NP_638078.1
LT XCC2730
SY
OR NC_003902 from 3236751 to 3237758 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MRGIRLQQPAGLASLSSVALPDPGQPAAGQIRVRLHASSLNFHDLGIVSG
QMPTADGRIPMSDGAGVVEAVGEAVSDFAVGDHVVSTFFPQWLDGEPLHA
GFATTPGDGVDGYARSAVVAAAQAFTHAPRGYSHAEAATLTTAGVTAWRA
LVVNGRIKAGDTVLVLGTGGVSIFALQFAKAMGAMVIVTSSSDQKLETAR
TLGADHCINYRQHTEWAAQVLEITNGRGVDHVVEVGGPGTLAQSIKAARV
GGHIALIGVLTGAAGPVPTAEMMGRQQRLQGLVVGSRRHQQELVRALDGL
PLRPVIDRSFALEDIAEAFALQHAGGHLGKIVLEF
xansp

NP_636133.1 lcl|XCC0742

25

335

S=169 I=29 E=6.64619e-14

quinone reductase

xansp

NP_638735.1 lcl|XCC3389

136

335

S=118 I=27 E=8.44148e-08

alcohol dehydrogenase C

xansp

NP_638821.1 lcl|adhC-XCC3475

181

333

S=114 I=33 E=2.4243e-07

alcohol dehydrogenase class III

xansp

NP_636331.1 lcl|tdh-XCC0945

173

335

S=108 I=26 E=1.5801e-06

L-threonine 3-dehydrogenase

xansp

NP_635424.1 lcl|yahK-XCC0029

135

294

S=105 I=26 E=3.11912e-06

alcohol dehydrogenase

pubmed

1

334

S=460 I=34 E=4.40498e-47

Zinc-binding alcohol dehydrogenase (NADPH:quinone reductase or related Zn-dependent oxidoreductase)

Pubmed 18004300

 

prodomImg

pubmed

172

335

S=325 I=49 E=1.0038e-30

Putative formaldehyde dehydrogenase

Pubmed 15743951,9501423

 

prodomImg

pubmed

129

335

S=220 I=30 E=5.73298e-18

NADH:quinone reductase and related Zn-dependent oxidoreductases

Pubmed 15608629

 

prodomImg

pubmed

95

335

S=212 I=31 E=5.06999e-17

Putative NADPH:quinone oxidoreductase (Putative alcohol dehydrogenase) EC=1.1.1.1

Pubmed 9177244,9573182

 

prodomImg

pubmed

129

335

S=191 I=28 E=1.58604e-14

Putative quinone oxidoreductase EC=1.-.-.- ; Acetylation Alternative splicing Polymorphism

Pubmed 9305847,15067011

 

prodomImg

pubmed

129

333

S=187 I=31 E=5.14626e-14

Putative NADPH:quinone oxidoreductase GrhO7

Pubmed 12323376

 

prodomImg

pubmed

129

333

S=182 I=31 E=2.30553e-13

Putative oxidoreductase

Pubmed 15068372

 

prodomImg

pubmed

129

334

S=180 I=34 E=3.4431e-13

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

29

335

S=179 I=26 E=4.43362e-13

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8049268

 

prodomImg

pubmed

107

334

S=179 I=29 E=5.05308e-13

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 1735726,4578954

 

prodomImg

sp

1

334

S=474 I=34 E=5.3437e-49

Zinc-type alcohol dehydrogenase-like protein C1773.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

129

335

S=191 I=28 E=9.98846e-15

Putative quinone oxidoreductase - Homo sapiens (Human)

Pubmed 9305847,15067011,17224074,

 

prodomImg

sp

29

335

S=179 I=26 E=2.79218e-13

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

107

334

S=179 I=29 E=3.1823e-13

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 1735726,4578954,436831,8049268,

 

prodomImg

sp

29

333

S=174 I=27 E=1.28405e-12

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8020473,

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

122

310

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

14

335

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF21]

14

335

-

Iprscan IPR013149 [PF00107]

159

299

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

28

85

Alcohol dehydrogenase GroES-like

Iprscan [seg]

114

128

-

Iprscan [seg]

162

171

-

Iprscan [seg]

64

75

-

Iprscan IPR011032 [SSF50129]

1

163

GroES-like

Iprscan IPR016040 [SSF51735]

133

297

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one avE1w9rC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

159 hits
swiss-prot

Swiss-Prot ncbi-blastp

122 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits