Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2622trxNP_637970.1thioredoxin

trx XCC2622
XCC2621
XCC2621
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2623
XCC2623
ID trx
AC NP_637970.1
LT XCC2622
SY
OR NC_003902 from 3109664 to 3110521 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE thioredoxin
IP Thioredoxin; Thioredoxin-like fold; Thioredoxin family; ;
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: glycerol ether metabolic process (GO:0006662)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
PM
AN
SQ 285 aa
 
........10........20........30........40........50
| | | | |
MSDKAHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKL
AADYNGAFELAKVDVDKEQQIAAAFQIRSVPTVFLVKGGELVDGFPGAMP
EGQIREFLTQHGVLPAEPQVAEEVPLAPLDPQAQVAALREAIAAEPDKDE
LKLDLALALLKTGDTLEAEQLIDALPANLATDDRAVRAKARLGFANVLKD
APDAAALQTTVAADGSDLHARHLLGVRHLLDGDDEAALEQFLEMLRQNRG
FEDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALLF
xansp

NP_639122.1 lcl|trxA-XCC3777

1

108

S=240 I=45 E=1.11977e-22

thioredoxin

xansp

NP_636554.1 lcl|trx-XCC1180

27

111

S=170 I=42 E=3.19444e-14

thioredoxin

xansp

NP_635477.1 lcl|trxA-XCC0082

29

92

S=107 I=31 E=1.53891e-06

thioredoxin

pubmed

18

285

S=281 I=29 E=1.50904e-25

YcaC

Pubmed 11325940

 

prodomImg

pubmed

8

111

S=266 I=45 E=9.57361e-24

Thioredoxin ; Electron transport Redox-active center

Pubmed 3294835

 

prodomImg

pubmed

10

111

S=253 I=43 E=4.1026e-22

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 3096973,3926769

 

prodomImg

pubmed

1

108

S=252 I=44 E=6.12687e-22

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 1561103,8253691

 

prodomImg

pubmed

1

108

S=252 I=44 E=6.12687e-22

Thioredoxin-1 ; Electron transport Host-virus interaction Redox-active center

Pubmed 6098320,6099324

 

prodomImg

pubmed

6

111

S=243 I=40 E=6.73795e-21

Thioredoxin ; Chloroplast Electron transport Plastid Redox-active center

Pubmed 8003693

 

prodomImg

pubmed

10

111

S=238 I=41 E=2.91515e-20

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 2492995

 

prodomImg

pubmed

10

108

S=238 I=41 E=2.9924e-20

Thioredoxin C-1 ; Electron transport Redox-active center

Pubmed 7021558

 

prodomImg

pubmed

10

110

S=234 I=40 E=7.54031e-20

TrxA

Pubmed 15547262

 

prodomImg

pubmed

1

108

S=234 I=44 E=9.29535e-20

Thioredoxin ; Electron transport Redox-active center

Pubmed 7496529

 

prodomImg

sp

6

285

S=308 I=31 E=5.27173e-29

Uncharacterized protein ybbN - Escherichia coli (strain K12)

 

prodomImg

sp

8

111

S=266 I=45 E=6.03565e-24

Thioredoxin - Chlorobium limicola f.sp. thiosulfatophilum

Pubmed 3294835,

 

prodomImg

sp

1

111

S=256 I=43 E=1.11024e-22

Thioredoxin-2 - Chlorobium tepidum

 

prodomImg

sp

10

111

S=253 I=43 E=2.58647e-22

Thioredoxin-1 - Anabaena sp. (strain PCC 7120)

 

prodomImg

sp

10

111

S=253 I=43 E=2.58647e-22

Thioredoxin-1 - Anabaena sp. (strain PCC 7119)

Pubmed 3096973,3926769,

 

prodomImg

Iprscan IPR006662 [PR00421]

28

36

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

36

45

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

76

87

Thioredoxin-like subdomain

Iprscan IPR012335 [G3DSA:3.40.30.10]

4

111

Thioredoxin fold

Iprscan [PTHR10438:SF13]

16

110

-

Iprscan IPR015467 [PTHR10438]

16

110

Thioredoxin, core

Iprscan IPR013766 [PF00085]

6

111

Thioredoxin domain

Iprscan IPR005746 [TIGR01068]

10

112

Thioredoxin

Iprscan IPR017937 [PS00194]

29

47

Thioredoxin, conserved site

Iprscan IPR017936 [PS51352]

1

113

Thioredoxin-like

Iprscan [seg]

144

161

-

Iprscan IPR012336 [SSF52833]

7

117

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3MEybqXb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

349 hits
swiss-prot

Swiss-Prot ncbi-blastp

292 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits