Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2579NP_637927.1reductase

XCC2579
XCC2578
XCC2578
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2580
XCC2580
ID
AC NP_637927.1
LT XCC2579
SY
OR NC_003902 from 3063048 to 3064418 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE reductase
IP Mercuric reductase; Glutathione reductase;
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: FAD binding (GO:0050660)
PM
AN
SQ 456 aa
 
........10........20........30........40........50
| | | | |
MSARYDYDVVVLGGGSGGLAAAFRAAKHGARVAIMEPGELGGTCVNLGCV
PKKAMWLAADLASKIELAGALGFDVVRPTLTWQELVTHRQGYIGNIHASY
RRRLDDDGVVLIPQRGVLQDRHTLMGADGVPVTAEHIVIATGAHPLRPHV
EGAEHGHVSDDFFNLCHAPDHVAIVGGGYIAVEIAGLLQALGSRVHLFVQ
GERLLERFDAELTLQLADNLRHLGVRLHFGFRTTGVQRDDTGKLRMRGHS
AHPGELGNDVFDQVFFAIGRRANTAGLGLEALGVELGKKGEIVVDDGQTT
NVPNIHAVGDVDGKVGLTPVAIAAGRKLMDRLFGGQPDARMDYDNVPSVV
FSHPPLGAVGLTEEQARERYDGAVRVYRSNFRPMLHALADAPQRSVFKLV
CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSE
EIVLMH
xansp

NP_635936.1 lcl|lpdA-XCC0544

40

452

S=328 I=28 E=4.24259e-33

dihydrolipoamide dehydrogenase

xansp

NP_639231.1 lcl|XCC3891

7

367

S=231 I=27 E=2.28151e-21

mercuric reductase

xansp

NP_636857.1 lcl|ldp-XCC1485

40

367

S=152 I=20 E=9.88276e-12

dihydrolipoamide dehydrogenase

pubmed

31

455

S=859 I=44 E=3.15791e-95

Glutathione reductase EC=1.8.1.7 ; Cytoplasm FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 8525054

 

prodomImg

pubmed

31

455

S=843 I=43 E=2.79038e-93

Glutathione reductase EC=1.8.1.7 ; Cytoplasm FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 3521741,8041620

 

prodomImg

pubmed

31

455

S=838 I=42 E=9.7931e-93

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 11160120

 

prodomImg

pubmed

31

455

S=787 I=41 E=1.67304e-86

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 14563169

 

prodomImg

pubmed

6

455

S=786 I=40 E=2.19225e-86

Glutathione reductase, mitochondrial EC=1.8.1.7 ; Acetylation Alternative initiation Cytoplasm FAD Flavoprotein Mitochondrion NADP Oxidoreductase

Pubmed 2185014,10708558

 

prodomImg

pubmed

31

455

S=780 I=41 E=9.73602e-86

Glutathione reductase, mitochondrial EC=1.8.1.7 ; Acetylation Alternative initiation Cytoplasm FAD Flavoprotein Mitochondrion NADP Oxidoreductase

Pubmed 9268726,2185014

 

prodomImg

pubmed

32

455

S=767 I=40 E=3.66073e-84

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 17079028

 

prodomImg

pubmed

31

455

S=759 I=39 E=3.85411e-83

Glutathione reductase EC=1.8.1.7 ; Cytoplasm FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 9287302,10620777

 

prodomImg

pubmed

1

455

S=755 I=38 E=1.01444e-82

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 16549667

 

prodomImg

pubmed

32

455

S=746 I=39 E=1.39947e-81

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 9271084

 

prodomImg

sp

31

455

S=859 I=44 E=1.98759e-95

Glutathione reductase - Streptococcus thermophilus

Pubmed 8525054,

 

prodomImg

sp

31

455

S=843 I=43 E=1.75627e-93

Glutathione reductase - Escherichia coli (strain K12)

Pubmed 3521741,8041620,2006135,8061609,

 

prodomImg

sp

6

453

S=803 I=40 E=1.23401e-88

Glutathione reductase, mitochondrial precursor - Callithrix jacchus (Common marmoset)

 

prodomImg

sp

6

455

S=786 I=40 E=1.3798e-86

Glutathione reductase, mitochondrial precursor - Homo sapiens (Human)

Pubmed 2185014,10708558,16421571,7060551,923580,7334521,3656429,8626496,9174360,9546215,

 

prodomImg

sp

31

455

S=780 I=41 E=6.12786e-86

Glutathione reductase, mitochondrial precursor - Mus musculus (Mouse)

Pubmed 9268726,2185014,

 

prodomImg

Iprscan [PD000139]

141

211

-

Iprscan IPR013027 [PR00368]

137

146

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

171

196

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

262

276

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

305

312

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

8

30

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan [PR00411]

137

146

-

Iprscan [PR00411]

171

196

-

Iprscan [PR00411]

262

276

-

Iprscan [PR00411]

305

312

-

Iprscan [PR00411]

342

363

-

Iprscan [PR00411]

40

55

-

Iprscan [PR00411]

408

423

-

Iprscan [PR00411]

430

450

-

Iprscan [PR00411]

8

30

-

Iprscan IPR000815 [PR00945]

138

155

Mercuric reductase

Iprscan IPR000815 [PR00945]

18

36

Mercuric reductase

Iprscan IPR000815 [PR00945]

191

206

Mercuric reductase

Iprscan IPR004099 [G3DSA:3.30.390.30]

345

455

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan [G3DSA:3.50.50.60]

4

344

-

Iprscan [PTHR22912]

10

456

-

Iprscan [PTHR22912:SF27]

10

456

-

Iprscan IPR001327 [PF00070]

171

269

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR004099 [PF02852]

346

456

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR013027 [PF07992]

8

316

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR012999 [PS00076]

41

51

Pyridine nucleotide-disulphide oxidoreductase, class I, active site

Iprscan [seg]

13

30

-

Iprscan [seg]

275

291

-

Iprscan [seg]

399

416

-

Iprscan [SSF51905]

6

306

-

Iprscan IPR016156 [SSF55424]

343

456

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YfCwUmCG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

319 hits
swiss-prot

Swiss-Prot ncbi-blastp

203 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

31 hits