Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2536NP_637884.2phosphodiesterase

XCC2536
XCC2535
XCC2535
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2537
XCC2537
ID
AC NP_637884.2
LT XCC2536
SY
OR NC_003902 from 3008516 to 3010879 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE phosphodiesterase
IP Protease inhibitor I4, serpin; Histidine kinase, HAMP region; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO Biological Process: signal transduction (GO:0007165)
Cellular Component: membrane (GO:0016020)
Molecular Function: serine-type endopeptidase inhibitor activity (GO:0004867)
Molecular Function: signal transducer activity (GO:0004871)
PM
AN
SQ 787 aa
 
........10........20........30........40........50
| | | | |
MKAMRLHTRIAALLVLVVLGTQALTFIAVQVATERSVKAQLGEELLIGER
VWQRINQRRDEQLLQSASVLADDFGFRAAVASGDVPTMQSALRNHAARMD
AQTAVLLSPEGDFLTGLADLPQAEQLRAVQALLQQAQHDGRAVGVVALDQ
HIVRLAVVQVLAPSRVGWIAIGNESGDSLAQDFRSTTGLDATFFIDGAPP
RVLASTLQPAERTEFAQQLRTAEHAQGAAIPLTLGDSRYLVKLQSIQGDT
RVRVALQASLDRAVAPYRTLKLRILLLAGLATAAALGVSIFLARSVSKPV
ALLVQAARRIQRGDYHTTVQLPPGRELAELADSFGRMQQQIATREQHILH
QARHDALTGLPNRIWLLEQLQQVVDQTVASGGTAAVLILDLERFKELNDS
LGHDFADQVLVEAGRRLADVVQAPNIVGRLGSDEFMVVVAHADPATVQEE
AQRLLLQLRSPLALPQARIQLEASIGIALIPEHGADPDTLLRRADIARGQ
VGDTASGASVYRLGQDEQHLRRLRLTGDLRQAIGGNELTLRFQPKISLRT
DQVEQVEVLVRWHHPVLGPIGPDEFIPLAEHSGVIHPLTRFVLDEALHCQ
SQWRAQGLELGMAINLSALDLSDPGLPDFVRGCLQRHAVPATSVTLELTE
SALMRDVEFALHMLHQLRNVGVRLSVDDFGTGYSSLAQLKRMPVNELKID
KSFVMQLAEGTDDAFIVRSTIDLGHNLGLSVIAEGVENDTALALLRGYGC
DMVQGYLYSPPLEEKPLLAWCMRQLGRSPVAQAGGQR
xansp

NP_637629.1 lcl|XCC2274

290

762

S=746 I=37 E=1.74841e-83

GGDEF family protein

xansp

NP_637276.1 lcl|XCC1911

337

774

S=675 I=38 E=7.78074e-75

GGDEF family protein

xansp

NP_637230.1 lcl|pdeA-XCC1865

349

770

S=659 I=36 E=6.24645e-73

c-di-GMP phosphodiesterase A

xansp

NP_637325.2 lcl|XCC1959

352

770

S=633 I=38 E=8.30806e-70

hypothetical protein

xansp

NP_637143.1 lcl|XCC1777

358

770

S=594 I=35 E=5.49187e-65

hypothetical protein

xansp

NP_637323.1 lcl|pdeA-XCC1958

369

762

S=559 I=35 E=9.23549e-61

c-di-GMP phosphodiesterase A

xansp

NP_637388.1 lcl|XCC2023

487

763

S=464 I=38 E=3.07464e-49

hypothetical protein

xansp

NP_638051.1 lcl|vieA-XCC2703

529

770

S=453 I=42 E=5.95945e-48

response regulator

xansp

NP_637989.1 lcl|XCC2641

348

764

S=404 I=31 E=4.89471e-42

hypothetical protein

xansp

NP_639217.1 lcl|XCC3877

521

776

S=386 I=37 E=6.92568e-40

hypothetical protein

pubmed

334

762

S=780 I=37 E=2.01032e-85

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

329

762

S=715 I=37 E=1.3726e-77

Putative uncharacterized protein SEA0008

Pubmed 6129240

 

prodomImg

pubmed

339

773

S=707 I=36 E=1.47053e-76

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

339

770

S=703 I=35 E=3.87058e-76

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

339

773

S=700 I=35 E=9.6685e-76

PDEA1

Pubmed 15042328

 

prodomImg

pubmed

339

774

S=693 I=35 E=7.05801e-75

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

326

768

S=678 I=36 E=4.43887e-73

Putative uncharacterized protein RMe0348 (Diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(S)) ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

pubmed

326

762

S=657 I=36 E=1.59648e-70

MorA

Pubmed 15489433

 

prodomImg

pubmed

311

765

S=654 I=34 E=3.43855e-70

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

345

762

S=647 I=36 E=2.71505e-69

Multidomain signal-transduction protein

Pubmed 16436438

 

prodomImg

sp

337

769

S=737 I=38 E=1.83019e-80

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

345

770

S=704 I=39 E=2.20978e-76

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

sp

325

770

S=665 I=36 E=1.05796e-71

Phytochrome-like protein cph2 - Synechocystis sp. (strain PCC 6803)

Pubmed 10978170,11063585,

 

prodomImg

sp

335

497

S=129 I=26 E=9.3455e-07

Phytochrome-like protein cph2 - Synechocystis sp. (strain PCC 6803)

Pubmed 10978170,11063585,

 

prodomImg

sp

352

762

S=651 I=37 E=4.99004e-70

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

Iprscan [G3DSA:3.30.70.270]

343

520

-

Iprscan IPR001633 [PF00563]

521

761

EAL

Iprscan IPR003660 [PF00672]

274

343

Signal transduction histidine kinase, HAMP region

Iprscan IPR000160 [PF00990]

348

497

GGDEF

Iprscan IPR001633 [SM00052]

521

766

EAL

Iprscan IPR000160 [SM00267]

341

511

GGDEF

Iprscan IPR003660 [SM00304]

294

346

Signal transduction histidine kinase, HAMP region

Iprscan IPR000160 [TIGR00254]

348

513

GGDEF

Iprscan IPR000215 [PS00284]

697

707

Protease inhibitor I4, serpin

Iprscan IPR001633 [PS50883]

522

775

EAL

Iprscan IPR003660 [PS50885]

294

346

Signal transduction histidine kinase, HAMP region

Iprscan IPR000160 [PS50887]

382

516

GGDEF

Iprscan [SignalP-NN(euk)]

1

23

-

Iprscan [tmhmm]

10

32

-

Iprscan [tmhmm]

274

293

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XwloFwjZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

111 hits
swiss-prot

Swiss-Prot ncbi-blastp

58 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

34 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits