Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2500NP_637850.1hypothetical protein

XCC2500
XCC2499
XCC2499
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2501
XCC2501
ID
AC NP_637850.1
LT XCC2500
SY
OR NC_003902 from 2972830 to 2973150 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE hypothetical protein
IP Glutaredoxin-related protein; Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
PM
AN
SQ 106 aa
 
........10........20........30........40........50
| | | | |
MPVMERIQAEVEQHPIVLFMKGTPQFPMCGFSSRAVQALVAAGADQLRTV
NVLEEPEIRANLPRYSNWPTFPQLFIHGELIGGCDITMELFEAGELKRIV
SEAYQP
xansp

NP_638714.2 lcl|XCC3368

5

101

S=235 I=44 E=9.94519e-23

glutaredoxin-like protein

pubmed

1

103

S=302 I=48 E=6.30767e-29

Glutaredoxin-4 ; Cytoplasm Electron transport Redox-active center

Pubmed 9511768

 

prodomImg

pubmed

3

103

S=288 I=50 E=2.89831e-27

Glutaredoxin-like protein

Pubmed 12065505

 

prodomImg

pubmed

5

102

S=269 I=52 E=6.62426e-25

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

5

106

S=254 I=44 E=3.95374e-23

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

5

102

S=224 I=43 E=1.86174e-19

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

4

103

S=260 I=44 E=7.67618e-24

Probable monothiol glutaredoxin-2 ; Electron transport Redox-active center

Pubmed 9274032

 

prodomImg

pubmed

6

96

S=259 I=54 E=9.05918e-24

Putative uncharacterized protein

Pubmed 12904565

 

prodomImg

pubmed

5

103

S=259 I=51 E=9.71362e-24

Monothiol glutaredoxin-S14, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 12480930

 

prodomImg

pubmed

3

103

S=257 I=46 E=1.69714e-23

Putative glutaredoxin-like protein

Pubmed 15365646

 

prodomImg

pubmed

5

96

S=253 I=45 E=5.65269e-23

Glutaredoxin-related protein 5 ; Polymorphism

Pubmed 16110529

 

prodomImg

sp

3

102

S=326 I=52 E=4.44448e-32

Glutaredoxin-4 - Shigella flexneri

 

prodomImg

sp

3

102

S=326 I=52 E=4.44448e-32

Glutaredoxin-4 - Escherichia coli (strain K12)

Pubmed 7559321,15833738,15840565,

 

prodomImg

sp

3

102

S=326 I=52 E=4.44448e-32

Glutaredoxin-4 - Escherichia coli O6

 

prodomImg

sp

3

102

S=326 I=52 E=4.44448e-32

Glutaredoxin-4 - Escherichia coli O157:H7

 

prodomImg

sp

1

103

S=321 I=55 E=2.21074e-31

Glutaredoxin-4 - Buchnera aphidicola subsp. Schizaphis graminum

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

3

100

Thioredoxin fold

Iprscan IPR014434 [PIRSF005894]

1

106

Monothiol glutaredoxin

Iprscan IPR004480 [PTHR10293]

5

104

Glutaredoxin-related protein

Iprscan IPR002109 [PF00462]

16

81

Glutaredoxin

Iprscan IPR004480 [TIGR00365]

3

103

Glutaredoxin-related protein

Iprscan IPR002109 [PS51354]

4

106

Glutaredoxin

Iprscan IPR012336 [SSF52833]

6

103

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G95PTgr7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

33 hits
swiss-prot

Swiss-Prot ncbi-blastp

52 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits