Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2446gumJNP_637799.1GumJ protein

gumJ XCC2446
XCC2445
XCC2445
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2447
XCC2447
ID gumJ
AC NP_637799.1
LT XCC2446
SY
OR NC_003902 from 2906394 to 2907893 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE GumJ protein
IP Polysaccharide biosynthesis protein
CL
EC
GO Biological Process: polysaccharide biosynthetic process (GO:0000271)
Cellular Component: membrane (GO:0016020)
PM
AN
SQ 499 aa
 
........10........20........30........40........50
| | | | |
MTAETSTMTSPTPPPRSLGSRAAGGAAVTMIGQSAKMIVQFGGIVLLARL
LTPYDYGLMAMVTAIVGAAEILRDFGLSAAAVQAKHVSREQRDNLFWINS
GIGLMLSVVVFATAHWIADFYHEPALVTISQALAVTFLLNGMTTQYRAHL
SRGLRFGQVALSDVGSQVLGLGAAVAAALAGWGYWALIVQQVVQAIVNLI
IAGACARWLPRGYARQAPMRDFMSFGWNLMAAQLLGYASRNVGQVIIGWR
TGPDALGLYNRAFQLLMMPLNQINAPATSVALPVLSQLQDERERYSAFLL
RGQTVMVHLIFALFAFACALAMPLIVLVLGEQWREAVPLFQVLTLGGIFQ
TASYATYWVFLSKGLMREQLVYSLVGRILLIACIFVGSRWGAMGVAIGYS
FGLLLIWPLSLVWIGKITDAPVGALFVNAMRALVAYGIAGGCAYYASVTV
GGPLWQQLLVGAGAMALVCLLALAWPGFRRDVVAIVNIRKLLTQAKARR
pubmed

1

499

S=2084 I=84 E=0

GumJ

Pubmed 7565082

 

prodomImg

pubmed

16

417

S=1603 I=78 E=0

GumJ

Pubmed 10940020

 

prodomImg

pubmed

29

364

S=314 I=26 E=3.07209e-29

Teichuronic acid biosynthesis protein tuaB ; Cell membrane wall biogenesis/degradation Stress response Transmembrane

Pubmed 10048024

 

prodomImg

pubmed

38

364

S=309 I=27 E=1.31759e-28

Putative uncharacterized protein tuaB

Pubmed 17928718

 

prodomImg

pubmed

46

399

S=285 I=21 E=1.0296e-25

Lipopolysaccharide biosynthesis protein wzxC ; Cell inner membrane Transmembrane

Pubmed 8759852

 

prodomImg

pubmed

46

399

S=280 I=21 E=4.86035e-25

Flippase (Putative export protein)

Pubmed 11004393

 

prodomImg

pubmed

37

399

S=273 I=22 E=2.80385e-24

Uncharacterized membrane protein in cps region ; Cell Exopolysaccharide synthesis Transmembrane

Pubmed 7896702

 

prodomImg

pubmed

32

399

S=271 I=23 E=5.20712e-24

Wzx

Pubmed 15109730

 

prodomImg

pubmed

31

364

S=269 I=22 E=9.50312e-24

O-antigen flippase

Pubmed 11598067

 

prodomImg

pubmed

31

364

S=268 I=22 E=1.44417e-23

Wzx

Pubmed 15774901

 

prodomImg

sp

29

364

S=314 I=26 E=1.93457e-29

Teichuronic acid biosynthesis protein tuaB - Bacillus subtilis

Pubmed 10048024,

 

prodomImg

sp

46

399

S=285 I=21 E=6.48368e-26

Lipopolysaccharide biosynthesis protein wzxC - Escherichia coli (strain K12)

Pubmed 8759852,

 

prodomImg

sp

37

399

S=273 I=22 E=1.76566e-24

Uncharacterized membrane protein in cps region - Klebsiella pneumoniae

Pubmed 7896702,

 

prodomImg

sp

29

353

S=148 I=20 E=2.51478e-09

Succinoglycan biosynthesis transport protein exoT - Rhizobium meliloti (Sinorhizobium meliloti)

Pubmed 8226645,8226646,8118055,11481431,

 

prodomImg

sp

77

337

S=133 I=20 E=1.7869e-07

Amylovoran biosynthesis protein amsL - Erwinia amylovora (Fire blight bacteria)

Pubmed 7596293,

 

prodomImg

Iprscan IPR002797 [PF01943]

22

289

Polysaccharide biosynthesis protein

Iprscan [seg]

168

202

-

Iprscan [seg]

22

27

-

Iprscan [seg]

309

321

-

Iprscan [seg]

435

446

-

Iprscan [seg]

5

15

-

Iprscan [tmhmm]

127

144

-

Iprscan [tmhmm]

127

144

-

Iprscan [tmhmm]

164

186

-

Iprscan [tmhmm]

164

186

-

Iprscan [tmhmm]

191

210

-

Iprscan [tmhmm]

191

210

-

Iprscan [tmhmm]

307

329

-

Iprscan [tmhmm]

307

329

-

Iprscan [tmhmm]

339

361

-

Iprscan [tmhmm]

339

361

-

Iprscan [tmhmm]

370

392

-

Iprscan [tmhmm]

370

392

-

Iprscan [tmhmm]

396

415

-

Iprscan [tmhmm]

396

415

-

Iprscan [tmhmm]

422

444

-

Iprscan [tmhmm]

422

444

-

Iprscan [tmhmm]

454

476

-

Iprscan [tmhmm]

454

476

-

Iprscan [tmhmm]

95

117

-

Iprscan [tmhmm]

95

117

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AL5tbdlN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

26 hits