Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2386uppNP_637740.1uracil phosphoribosyltransferase

upp XCC2386
XCC2385
XCC2385
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2387
XCC2387
ID upp
AC NP_637740.1
LT XCC2386
SY
OR NC_003902 from 2821967 to 2822599 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE uracil phosphoribosyltransferase
IP Uracil phosphoribosyl transferase
CL
EC
GO Biological Process: uracil salvage (GO:0006223)
Biological Process: nucleoside metabolic process (GO:0009116)
Molecular Function: uracil phosphoribosyltransferase activity (GO:0004845)
PM
AN
SQ 210 aa
 
........10........20........30........40........50
| | | | |
MKIVEVRHPLVQHKIGLLRDAALSTKGFRELVTELGTLLAYEATANLDTE
SHVQPGWAGPVEVQRIAGAKITLVPILRAGLGMLPGVLALIPAARVSVVG
LQRDEETLQPVPYFERLTGRLEERDALILDPMLATGGTLIATIDMLKRAG
ARRIKGIFLVAAPEGLKALEAVHPDVEVYTAAIDDHLNEKGYILPGLGDA
GDRIFGTRVE
Hamap UPP_MF_01218_B raw_score=5879 norm_score=41.944

Uracil phosphoribosyltransferase [upp].

pubmed

1

208

S=750 I=66 E=1.5349e-82

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 1371255

 

prodomImg

pubmed

6

208

S=574 I=55 E=2.97722e-61

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 7961396

 

prodomImg

pubmed

6

208

S=560 I=51 E=1.5057e-59

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 8393068,8331080

 

prodomImg

pubmed

2

208

S=556 I=52 E=4.63658e-59

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 9268683,12037295

 

prodomImg

pubmed

2

208

S=551 I=51 E=1.80673e-58

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 11832506

 

prodomImg

pubmed

2

208

S=543 I=52 E=1.61178e-57

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 7798145

 

prodomImg

pubmed

2

208

S=512 I=49 E=9.85848e-54

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 10510230

 

prodomImg

pubmed

1

208

S=472 I=46 E=8.3915e-49

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 14762060

 

prodomImg

pubmed

1

207

S=458 I=48 E=3.59603e-47

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 18192381

 

prodomImg

pubmed

1

208

S=458 I=44 E=3.92363e-47

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 12949158

 

prodomImg

sp

1

210

S=1061 I=100 E=2.11212e-120

Uracil phosphoribosyltransferase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

210

S=1042 I=98 E=4.05492e-118

Uracil phosphoribosyltransferase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

210

S=1042 I=98 E=4.12625e-118

Uracil phosphoribosyltransferase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

210

S=1035 I=97 E=2.78484e-117

Uracil phosphoribosyltransferase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

208

S=781 I=68 E=1.93145e-86

Uracil phosphoribosyltransferase - Mannheimia succiniciproducens (strain MBEL55E)

 

prodomImg

Iprscan [G3DSA:3.40.50.2020]

6

208

-

Iprscan [PTHR10285:SF1]

1

207

-

Iprscan [PTHR10285]

1

207

-

Iprscan IPR000836 [PF00156]

17

179

Phosphoribosyltransferase

Iprscan IPR005765 [TIGR01091]

2

208

Uracil phosphoribosyl transferase

Iprscan [SSF53271]

3

208

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vowuBuKU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

31 hits
swiss-prot

Swiss-Prot ncbi-blastp

346 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

6 hits