Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2370fruBNP_637724.1multiphosphoryl transfer protein

fruB XCC2370
XCC2369
XCC2369
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2371
XCC2371
ID fruB
AC NP_637724.1
LT XCC2370
SY
OR NC_003902 from 2798588 to 2801104 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE multiphosphoryl transfer protein
IP Phosphotransferase system, phosphocarrier HPr protein; PEP-utilizing enzyme; Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2; Phosphoenolpyruvate-protein phosphotransferase; Pyruvate/Phosphoenolpyruvate kinase, catalytic core;
CL
EC
GO Biological Process: transport (GO:0006810)
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Biological Process: phosphorylation (GO:0016310)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: catalytic activity (GO:0003824)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 838 aa
 
........10........20........30........40........50
| | | | |
MSSPSIAPVTPDLVRLRATARDKDDAIAQAAQLLVAAGCVAPGYDASMRR
REGLANTFLGHGLAIPHGVGEDRHLVRRDGIAVLQLPEGVEWNPGQTTRL
VVGIAAQSDTHITLLRRLTRLIQDPAQLEALFTTDDPAVIVAALTGDRAP
DTSAAPATDLAERFEWTIAYPSGLHARPATRWAETARGFSARAQVRAGDQ
AADAKSLVGLLQLGLRAGDSITVSAKGSDAPALLKRLRAVMDSLTAQEKA
DAERAAQRRAAPVIGWTPPQAQPAIVGIGASPGVAIGIVHRLRAAQTEVA
DQPIGLGDGGVLLHDALTRTRQQLAAIQDDTQRRLGASDAAIFKAQAELL
NDTDLITRTCQLMVEGHGVAWSWHQAVEQIASGLAALGNPVLAGRAADLR
DVGRRVLAQLDPAAAGAGLTDLPEQPCILLAGDLSPSDTANLDTDCVLGL
ATAQGGPTSHTAILSRTLGLPALVAAGGQLLDIEDGVTAIIDGSSGRLYI
NPSELDLDAARTHIAEQQAIREREAAQRALPAETTDGHHIDIGANVNLPE
QVAMALTQGAEGVGLMRTEFLFLERGSTPTEDEQYQTYLAMARALDGRPL
IVRALDIGGDKQVAHLELPHEENPFLGVRGARLLLRRPDLLEPQLRALYR
AAKDGARLSIMFPMITSVPELISLREICARIRAELDAPELPIGIMIEVPA
AAAQADVLARHADFFSIGTNDLTQYVLAIDRQNPELAAEADSLHPAVLRM
IRSTIDGARKHDRWVGVCGGLAGDPFGASLLAGLGVQELSMTPNDIPAVK
ARLRGRALSALQQLAEQALQCETAEQVRALEAQREGQA
xansp

NP_638157.1 lcl|ptsI-XCC2809

277

804

S=574 I=32 E=1.57945e-62

phosphotransferase system enzyme I

xansp

NP_637522.1 lcl|ppsA-XCC2166

657

803

S=166 I=30 E=4.31632e-13

phosphoenolpyruvate synthase

pubmed

1

838

S=3631 I=87 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 7496537

 

prodomImg

pubmed

8

804

S=1386 I=41 E=7.92455e-159

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 2193161

 

prodomImg

pubmed

277

805

S=908 I=36 E=6.07123e-101

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Cytoplasm Magnesium Metal-binding Phosphotransferase Sugar trans

Pubmed 15670601

 

prodomImg

pubmed

272

804

S=809 I=35 E=6.3335e-89

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

277

798

S=800 I=35 E=8.73739e-88

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

275

805

S=796 I=36 E=2.4445e-87

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1655788

 

prodomImg

pubmed

275

805

S=790 I=36 E=1.37378e-86

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 2457575,2960675

 

prodomImg

pubmed

275

805

S=771 I=33 E=2.41721e-84

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 15590099

 

prodomImg

pubmed

278

804

S=769 I=34 E=4.22329e-84

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12855720

 

prodomImg

pubmed

275

805

S=759 I=36 E=7.24523e-83

PTS system enzyme I ; Cytoplasm Kinase Magnesium Metal-binding Phosphotransferase Sugar transport

Pubmed 12618440

 

prodomImg

sp

8

804

S=1386 I=41 E=4.9957e-159

Multiphosphoryl transfer protein - Rhodobacter capsulatus (Rhodopseudomonas capsulata)

Pubmed 2193161,

 

prodomImg

sp

275

803

S=832 I=35 E=7.17876e-92

Phosphoenolpyruvate-protein phosphotransferase - Bacillus halodurans

 

prodomImg

sp

275

804

S=824 I=34 E=6.86679e-91

Phosphoenolpyruvate-protein phosphotransferase - Bacillus megaterium

 

prodomImg

sp

272

804

S=815 I=35 E=7.29284e-90

Phosphoenolpyruvate-protein phosphotransferase - Bacillus sp. (strain S)

 

prodomImg

sp

272

804

S=809 I=35 E=3.99269e-89

Phosphoenolpyruvate-protein phosphotransferase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 7670643,

 

prodomImg

Iprscan [PD000940]

544

798

-

Iprscan [PD001689]

15

131

-

Iprscan [PD002238]

171

241

-

Iprscan IPR005698 [PR00107]

173

189

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

198

213

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

213

230

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR006318 [PR01736]

564

583

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

713

728

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

730

745

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

766

778

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

312

410

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

521

830

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR000032 [G3DSA:3.30.1340.10]

161

245

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR002178 [G3DSA:3.40.930.10]

9

148

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan [PTHR22931]

275

830

-

Iprscan [PTHR22931:SF10]

275

830

-

Iprscan IPR002178 [PF00359]

7

147

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR005698 [PF00381]

161

244

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR008279 [PF00391]

416

496

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PF02896]

521

808

PEP-utilizing enzyme

Iprscan IPR008731 [PF05524]

275

396

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR005698 [TIGR01003]

161

242

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR006318 [TIGR01417]

275

832

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR001020 [PS00369]

173

180

Phosphotransferase system, HPr histidine phosphorylation site

Iprscan IPR008279 [PS00370]

455

466

PEP-utilising enzyme, mobile region

Iprscan IPR002178 [PS00372]

52

68

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR002114 [PS00589]

199

214

Phosphotransferase system, HPr serine phosphorylation site

Iprscan IPR000121 [PS00742]

713

731

PEP-utilizing enzyme

Iprscan IPR002178 [PS51094]

7

147

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR000032 [PS51350]

161

253

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR008731 [SSF47831]

313

413

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [SSF51621]

519

816

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

394

520

PEP-utilising enzyme, mobile region

Iprscan IPR000032 [SSF55594]

162

249

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR016152 [SSF55804]

6

146

Phosphotransferase/anion transporter

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VeMj2a4E)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

83 hits
swiss-prot

Swiss-Prot ncbi-blastp

122 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

35 hits