Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2347guaANP_637701.1glutamine amidotransferase

guaA XCC2347
XCC2346
XCC2346
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2348
XCC2348
ID guaA
AC NP_637701.1
LT XCC2347
SY
OR NC_003902 from 2759384 to 2760139 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE glutamine amidotransferase
IP Peptidase C26;
CL
EC
GO Biological Process: glutamine metabolic process (GO:0006541)
Molecular Function: hydrolase activity (GO:0016787)
PM
AN
SQ 251 aa
 
........10........20........30........40........50
| | | | |
MTMVPLVGLPTDRSLHGPHPFLAAGEKYVRAVVEAAGAQPVLLPSLQPPL
DAGAWLQRLDGLLLTGAVSNVEPHHYSDEPSWEGNPHDPARDATSLALIP
QALARGLPVLAICRGLQEVNVALGGRLHQRVHEVPGLADHREDRSAPLDI
QYGPAHPVQLQPGGWLAGMSDTAQVQVNSLHGQGIATLAAGLLVEATAPD
GLIEAFRGPGPGFLLAVQWHPEWRVTQHPFYRAIFQAFGEACRQYAAQRG
K
pubmed

19

251

S=512 I=44 E=1.41169e-53

Glutamine amidotransferase ; Plasmid

Pubmed 15240330

 

prodomImg

pubmed

59

245

S=352 I=45 E=3.65721e-34

Putative glutamine amidotransferase

Pubmed 11679318,14711685

 

prodomImg

pubmed

5

235

S=224 I=31 E=9.67353e-19

Putative uncharacterized protein orf201

Pubmed 11807057

 

prodomImg

pubmed

52

235

S=218 I=35 E=5.15934e-18

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

52

235

S=218 I=34 E=5.77855e-18

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

52

235

S=216 I=34 E=1.10159e-17

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

56

242

S=196 I=40 E=2.38943e-15

Putative glutamine amidotransferase

Pubmed 12446651,12598647

 

prodomImg

pubmed

51

192

S=167 I=32 E=9.4509e-12

Putative glutamine amidotransferase-like protein yvdE homolog

Pubmed 1674656

 

prodomImg

pubmed

155

243

S=136 I=29 E=4.77172e-08

Putative glutamine amidotransferase-like protein RP404

Pubmed 11030655

 

prodomImg

pubmed

1

131

S=118 I=22 E=7.30279e-06

Putative glutamine amidotransferase-like protein RP404

Pubmed 11030655

 

prodomImg

sp

5

251

S=452 I=40 E=1.60258e-46

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Escherichia coli O157:H7

 

prodomImg

sp

5

251

S=451 I=40 E=2.45674e-46

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Shigella sonnei (strain Ss046)

 

prodomImg

sp

5

251

S=451 I=40 E=2.45674e-46

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Escherichia coli (strain K12)

Pubmed 15590624,

 

prodomImg

sp

5

251

S=432 I=39 E=3.826e-44

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Shigella flexneri

 

prodomImg

sp

55

238

S=256 I=37 E=9.55619e-23

Putative glutamine amidotransferase-like protein yvdE - Lactococcus lactis subsp. lactis (Streptococcus lactis)

 

prodomImg

Iprscan [G3DSA:3.40.50.880]

2

222

-

Iprscan IPR011697 [PF07722]

5

222

Peptidase C26

Iprscan IPR017926 [PS51273]

18

248

Glutamine amidotransferase type 1

Iprscan [seg]

39

50

-

Iprscan [SSF52317]

1

246

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ASZTgI01)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits