Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2237gaaNP_637592.1glutaryl-7-ACA acylase precursor

gaa XCC2237
XCC2236
XCC2236
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2238
XCC2238
ID gaa
AC NP_637592.1
LT XCC2237
SY
OR NC_003902 from 2634228 to 2636141 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE glutaryl-7-ACA acylase precursor
IP Casein, alpha/beta; CocE/NonD hydrolase; Galactose-binding like
CL
EC
GO Biological Process: proteolysis (GO:0006508)
Biological Process: transport (GO:0006810)
Biological Process: metabolic process (GO:0008152)
Cellular Component: extracellular region (GO:0005576)
Molecular Function: dipeptidyl-peptidase activity (GO:0008239)
Molecular Function: aminopeptidase activity (GO:0004177)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: transporter activity (GO:0005215)
PM
AN
SQ 637 aa
 
........10........20........30........40........50
| | | | |
MRRLAACLLATAVAAATSAALAQTSPMTPDITGKPFVAGDAANDYVKREV
MIPMRDGVKLHTVIVLPKGARNAPIVLTRTPYDASGRTERLASPHMKDLL
SAGDDVFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLNPSEVDHATDA
WDTIDWLVKNVKESNGKVGMIGSSYEGFTVVMALTNPHPALKVAAPESPM
IDGWMGDDWFNYGAFRQVNFDYFTGQLSKRGKGAGIPRQGHDDYSNFLQA
GSAGDFAKAAGLEQLPWWHKLTEHAAYDSFWQEQALDKVMARTPLKVPTM
WLQGLWDQEDMWGAIHSYAAMEPRDKSNKLNYLVMGPWRHSQVNSDASSL
GALNFDGDTARQFRRDVLRPFFDQYLVDGAPKAATPPVFIYNTGENHWDR
LQAWPRSCDKGCAAKSKPLYLQAGGKLSFQAPTAAQPAFEEYVSDPAKPV
PFVPRPVDFGDRSMWTTWLVHDQRFVDGRPDVLTFVTEPLTAPLQIAGAP
DVHLQASTSGSDSDWVVKLIDVYPDEMAADPKMGGYELPVSMAIFRGRYR
ESFSTPAPLAANQPLAFQFGLPTANHTFQPGHRVMVQVQSSLFPLYDRNP
QTYVPNVFFAKPGDYQKATQRVYVAPGQGSYISLPVR
pubmed

1

637

S=3126 I=91 E=0

Glutaryl-7-ACA acylase

Pubmed 12387744

 

prodomImg

pubmed

30

636

S=1972 I=61 E=0

Alpha-amino acid ester hydrolase EC=3.1.1.43

Pubmed 11772629

 

prodomImg

pubmed

43

636

S=444 I=28 E=7.60518e-45

Cocaine esterase EC=3.1.1.- ; Cytoplasm Hydrolase

Pubmed 10698749,11742345

 

prodomImg

pubmed

46

636

S=361 I=28 E=1.05044e-34

Glutaryl 7-ACA acylase ; Signal

Pubmed 1744041

 

prodomImg

pubmed

295

601

S=179 I=28 E=1.04946e-12

Putative diester hydrolase

Pubmed 10650222

 

prodomImg

pubmed

46

196

S=142 I=30 E=3.51429e-08

Putative diester hydrolase

Pubmed 10650222

 

prodomImg

sp

43

636

S=444 I=28 E=4.82114e-45

Cocaine esterase - Rhodococcus sp. (strain MB1 Bresler)

Pubmed 10698749,11742345,12369817,

 

prodomImg

sp

49

202

S=127 I=32 E=1.20808e-06

Uncharacterized protein Mb1866c - Mycobacterium bovis

 

prodomImg

sp

331

588

S=123 I=28 E=4.58598e-06

Uncharacterized protein Mb1866c - Mycobacterium bovis

 

prodomImg

sp

49

202

S=127 I=32 E=1.20808e-06

Uncharacterized protein Rv1835c/MT1883 - Mycobacterium tuberculosis

 

prodomImg

sp

331

588

S=123 I=28 E=4.58598e-06

Uncharacterized protein Rv1835c/MT1883 - Mycobacterium tuberculosis

 

prodomImg

Iprscan [G3DSA:2.60.120.260]

400

637

-

Iprscan [G3DSA:3.40.50.1820]

11

402

-

Iprscan IPR000383 [PF02129]

56

342

Peptidase S15

Iprscan IPR013736 [PF08530]

369

633

Peptidase S15/CocE/NonD, C-terminal

Iprscan IPR005674 [TIGR00976]

52

637

CocE/NonD hydrolase

Iprscan IPR001588 [PS00306]

7

14

Casein, alpha/beta

Iprscan [seg]

4

22

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan IPR008979 [SSF49785]

398

637

Galactose-binding like

Iprscan [SSF53474]

20

404

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ioXYkh5l)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits