Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC2166ppsANP_637522.1phosphoenolpyruvate synthase

ppsA XCC2166
XCC2165
XCC2165
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC2167
XCC2167
ID ppsA
AC NP_637522.1
LT XCC2166
SY
OR NC_003902 from 2553397 to 2555775 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE phosphoenolpyruvate synthase
IP Phosphoenolpyruvate synthase; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL
EC
GO Biological Process: gluconeogenesis (GO:0006094)
Biological Process: phosphorylation (GO:0016310)
Molecular Function: kinase activity (GO:0016301)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: catalytic activity (GO:0003824)
transferring phosphorus-containing groups (GO:0016772)
water dikinase activity (GO:0008986)
PM
AN
SQ 792 aa
 
........10........20........30........40........50
| | | | |
MNENILWLHELRLVDLARVGGKNSSLGEMIGNLAGLGVSVPGGYATTAEA
FKDFIAHNDLSKRIFDKLETLDVEDVTALTVAGKEIRGWVIDAPLQPELD
RDIRSAYEKLCAENGGGEVAVAVRSSATAEDLPDASFAGQQETFLNVTGA
DDVVHKVKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGVQLMVRSGVGSS
GVLFTLDTESGFRDVVFVTSSFGLGEMVVQGAVNPDEFYVYKPTLTAGKP
AILRRSLGSKAIRMVYSDVPGERVRIEDTPVELRNTFSISDEDVQELSKQ
ALVIEKHYGRPMDIEWAKDGVSGKLFIVQARPETVKSRSHATQIERFSLE
AKDAKILVEGRAVGAKIGSGVARVVRSLEDMNRVQAGDVLIADMTDPDWE
PVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGSGNATDVISDGQEVTV
SCAEGDTGFIYEGLLPFERTTTDLGNMPPAPLKIMMNVANPERAFDFGQL
PNAGIGLARLEMIIAAHIGIHPNALLEYDKQDADVRKKIDAKIAGYGDPV
SFYINRLAEGIATLTASVAPNTVIVRLSDFKSNEYANLIGGSRYEPHEEN
PMIGFRGASRYVDPSFTKAFSLECKAVLKVRNEMGLDNLWVMIPFVRTLE
EGRKVIEVLEQNGLKQGENGLKIIMMCELPSNALLADEFLEIFDGFSIGS
NDLTQLTLGLDRDSSIVAHLFDERNPAVKKLLSMAIKSARAKGKYVGICG
QGPSDHPELAEWLMQEGIESVSLNPDTVVDTWLRLAKLKSEG
xansp

NP_638157.1 lcl|ptsI-XCC2809

386

781

S=242 I=28 E=2.08076e-22

phosphotransferase system enzyme I

xansp

NP_637724.1 lcl|fruB-XCC2370

596

785

S=204 I=31 E=7.87239e-18

multiphosphoryl transfer protein

pubmed

1

792

S=4190 I=100 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; Kinase Magnesium Metal-binding Transferase

Pubmed 16109965

 

prodomImg

pubmed

1

786

S=2813 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 17038831

 

prodomImg

pubmed

5

789

S=2780 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 1310524

 

prodomImg

pubmed

1

781

S=2065 I=50 E=0

Putative phosphoenolpyruvate synthase

Pubmed 17351032

 

prodomImg

pubmed

5

781

S=1590 I=44 E=0

Probable phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7805870

 

prodomImg

pubmed

10

778

S=1067 I=38 E=3.03346e-120

Phosphoenolpyruvate synthase EC=2.7.9.2 ; Transferase

Pubmed 10430574

 

prodomImg

pubmed

510

787

S=1066 I=68 E=4.5302e-120

PpsA ; Kinase Magnesium Metal-binding Transferase

Pubmed 10438740

 

prodomImg

pubmed

60

778

S=1058 I=39 E=3.80211e-119

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7828869,7628701

 

prodomImg

pubmed

291

530

S=844 I=66 E=3.85248e-93

Phosphoenolpyruvate synthase

Pubmed 17189443

 

prodomImg

pubmed

291

528

S=844 I=67 E=3.88622e-93

Phosphoenolpyruvate synthase

Pubmed 17189443

 

prodomImg

sp

1

786

S=2813 I=65 E=0

Phosphoenolpyruvate synthase - Neisseria meningitidis serogroup B

Pubmed 17038831,

 

prodomImg

sp

5

789

S=2780 I=65 E=0

Phosphoenolpyruvate synthase - Escherichia coli (strain K12)

Pubmed 1310524,4293109,4319237,16880,

 

prodomImg

sp

11

786

S=2589 I=65 E=0

Phosphoenolpyruvate synthase - Deinococcus radiodurans

 

prodomImg

sp

5

789

S=2280 I=55 E=0

Phosphoenolpyruvate synthase - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

5

791

S=2254 I=53 E=0

Phosphoenolpyruvate synthase - Helicobacter pylori (Campylobacter pylori)

 

prodomImg

Iprscan [PD000940]

625

775

-

Iprscan IPR006318 [PR01736]

694

709

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

711

726

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

747

759

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR015813 [G3DSA:3.20.20.60]

480

789

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR013815 [G3DSA:3.30.1490.20]

2

193

ATP-grasp fold, subdomain 1

Iprscan IPR008279 [G3DSA:3.50.30.10]

348

462

PEP-utilising enzyme, mobile region

Iprscan [PTHR22931]

8

784

-

Iprscan [PTHR22931:SF7]

8

784

-

Iprscan IPR008279 [PF00391]

377

458

PEP-utilising enzyme, mobile region

Iprscan IPR002192 [PF01326]

4

361

Pyruvate phosphate dikinase, PEP/pyruvate-binding

Iprscan IPR000121 [PF02896]

573

790

PEP-utilizing enzyme

Iprscan IPR006319 [TIGR01418]

4

790

Phosphoenolpyruvate synthase

Iprscan IPR008279 [PS00370]

414

425

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PS00742]

694

712

PEP-utilizing enzyme

Iprscan IPR015813 [SSF51621]

461

791

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

344

467

PEP-utilising enzyme, mobile region

Iprscan [SSF56059]

1

386

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6JjcbG0B)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

123 hits
swiss-prot

Swiss-Prot ncbi-blastp

112 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits