Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1989moeBNP_637354.1molybdopterin biosynthesis protein MoeB

moeB XCC1989
XCC1988
XCC1988
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1990
XCC1990
ID moeB
AC NP_637354.1
LT XCC1989
SY
OR NC_003902 from 2335335 to 2336471 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE molybdopterin biosynthesis protein MoeB
IP Rhodanese-like; Molybdenum cofactor biosynthesis;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 378 aa
 
........10........20........30........40........50
| | | | |
MSHDLSPAQARARALRGALLIDIRQPHERVSGQAEGALAIAQADLEQAPA
QHLPDRDRDILLICQSGKRSAQTAAQLREQGYPHALSVLGGTTAWSRDGL
PLVRPTLPSDETDFLERYSRHLRLPQVGIDGQQRLARARVLLIGAGGLGS
PAAFYLAAAGVGHLRMADDDVVDRSNLQRQILHTEDSVGMAKVVSAAQRI
AALNPRVQVDAIQTRVTASNIEALLQDVDVVVDGADNFAARYLLNDACVK
LGKPLVYGAVQQFEGQLSVFDAGRHRGQLPCYRCLFPEPPPPEFAPSCAE
AGVLGVLPGVIGLLQATEAIKLLLGLGDSLAGRLLSFDALAMRFREIRLP
PDPQCPVCAPGTAFPGYADYATFCGTPA
xansp

NP_636798.1 lcl|moeB-XCC1425

111

256

S=169 I=37 E=7.03077e-14

molybdopterin biosynthesis protein

xansp

NP_635597.1 lcl|XCC0202

21

104

S=95 I=27 E=5.51446e-05

hypothetical protein

pubmed

117

377

S=584 I=47 E=4.34579e-62

MPT-synthase sulfurylase

Pubmed 10622725

 

prodomImg

pubmed

21

108

S=115 I=34 E=3.27461e-05

MPT-synthase sulfurylase

Pubmed 10622725

 

prodomImg

pubmed

101

375

S=535 I=45 E=4.51674e-56

QbsC

Pubmed 15066027

 

prodomImg

pubmed

100

375

S=529 I=45 E=2.0235e-55

PdtF

Pubmed 14756880

 

prodomImg

pubmed

115

375

S=517 I=45 E=6.56023e-54

MoeB-like protein

Pubmed 11873910

 

prodomImg

pubmed

115

375

S=517 I=45 E=6.56023e-54

Putative sulfurylase

Pubmed 11234929,11525988

 

prodomImg

pubmed

113

364

S=482 I=42 E=1.03789e-49

Molybdenum cofactor synthesis protein 3 EC=6.-.-.- ; Alternative splicing Ligase biosynthesis

Pubmed 9628582

 

prodomImg

pubmed

110

365

S=427 I=41 E=4.875e-43

Adenylyltransferase thiF EC=2.7.7.- ; Nucleotidyltransferase Thiamine biosynthesis

Pubmed 8432721,8265357

 

prodomImg

pubmed

117

376

S=422 I=39 E=1.96705e-42

Molybdenum cofactor biosynthetic protein (Putative uncharacterized protein)

Pubmed 9614089

 

prodomImg

pubmed

116

357

S=416 I=38 E=1.12491e-41

Probable molybdopterin biosynthesis protein moeB ; Chloroplast Nucleotidyltransferase Plastid Thiamine

Pubmed 15638458

 

prodomImg

sp

115

374

S=489 I=39 E=9.03091e-51

Molybdenum cofactor synthesis protein 3 - Dictyostelium discoideum (Slime mold)

 

prodomImg

sp

113

364

S=482 I=42 E=6.53534e-50

Molybdenum cofactor synthesis protein 3 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 9628582,

 

prodomImg

sp

117

349

S=477 I=38 E=2.73058e-49

Probable molybdopterin biosynthesis protein moeB - Porphyra purpurea

 

prodomImg

sp

113

378

S=447 I=41 E=1.02498e-45

Molybdenum cofactor synthesis protein 3 - Homo sapiens (Human)

 

prodomImg

sp

113

378

S=433 I=42 E=5.70551e-44

Molybdenum cofactor synthesis protein 3 - Mus musculus (Mouse)

 

prodomImg

Iprscan IPR001763 [G3DSA:3.40.250.10]

5

112

Rhodanese-like

Iprscan IPR016040 [G3DSA:3.40.50.720]

112

360

NAD(P)-binding

Iprscan [PTHR10953]

93

358

-

Iprscan IPR000594 [PF00899]

136

270

UBA/THIF-type NAD/FAD binding fold

Iprscan IPR007901 [PF05237]

277

362

MoeZ/MoeB

Iprscan IPR001763 [SM00450]

5

101

Rhodanese-like

Iprscan IPR001763 [PS50206]

14

104

Rhodanese-like

Iprscan [seg]

287

301

-

Iprscan [seg]

302

314

-

Iprscan [seg]

8

20

-

Iprscan IPR001763 [SSF52821]

2

104

Rhodanese-like

Iprscan IPR009036 [SSF69572]

115

359

Molybdenum cofactor biosynthesis, MoeB

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QT6rAqnZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

91 hits
swiss-prot

Swiss-Prot ncbi-blastp

79 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits