Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1958pdeANP_637323.1c-di-GMP phosphodiesterase A

pdeA XCC1958
XCC1957
XCC1957
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1960
XCC1960
ID pdeA
AC NP_637323.1
LT XCC1958
SY
OR NC_003902 from 2291266 to 2292987 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE c-di-GMP phosphodiesterase A
IP Cyclic nucleotide-binding; CheY-like; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
PM
AN
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MWSPVIPPGLEIVKPTRLGAGNPELLHLVDAAASGGPPLMIFHIDIDHFA
SINENMSGEVGDQALTLTARRLQEFLGTRGKLWRHGSDEMIVVAVRREDT
PLPEDFAEEIRQQLELPLSVLPYTLFMTGKVGISLCPEHSTSLSTLLDYA
EEASYQAAREGGNTVRLYTRNSATNAHSESIIARQIVDAIPHGELRLRYQ
PLVSARDGRIVGMEALLRWQSPTLGMLVPERFMRTAERLGVIVQIGEWVL
QNAVRQARLWRDQGFDDFSIAVNVSTLQLLRPGFFNEVMAMLQTAGVPAQ
FVTLEINESALTNNVNFVHETMANLRNEGISLSLDNFGTGDSSLSALVRY
PVDRLKIDRSFIKSAPAGSREAAIARAIIAMGHQLGMTVIANGVESQAQL
GFLRRNDCDIFQGYLFGEPMSAESAGMALRRRYLRPESFAESRPDRTLLL
LDDEENVLRSLVRLFRRDGYRILAAGNVRDAFDLLATNDVQVILSDQRMS
DMSGTEFLGRVKMLYPDTVRLVLSGYTDLATVTEAINRGAIYRFLTKPWN
DDELREHIRQAFRTHDELRNGRE
xansp

NP_637276.1 lcl|XCC1911

36

420

S=592 I=36 E=5.60376e-65

GGDEF family protein

xansp

NP_637884.2 lcl|XCC2536

24

420

S=586 I=35 E=2.91158e-64

phosphodiesterase

xansp

NP_637629.1 lcl|XCC2274

27

421

S=564 I=35 E=1.49715e-61

GGDEF family protein

xansp

NP_637230.1 lcl|pdeA-XCC1865

28

424

S=532 I=33 E=1.17918e-57

c-di-GMP phosphodiesterase A

xansp

NP_637325.2 lcl|XCC1959

32

430

S=523 I=34 E=1.53043e-56

hypothetical protein

xansp

NP_637143.1 lcl|XCC1777

194

424

S=414 I=37 E=1.98372e-43

hypothetical protein

xansp

NP_638051.1 lcl|vieA-XCC2703

189

420

S=383 I=38 E=1.34717e-39

response regulator

xansp

NP_637388.1 lcl|XCC2023

193

422

S=362 I=34 E=4.40212e-37

hypothetical protein

xansp

NP_639217.1 lcl|XCC3877

189

435

S=317 I=34 E=1.14384e-31

hypothetical protein

pubmed

420

573

S=769 I=98 E=2.93924e-84

Genes for sensor and regulator protein

Pubmed 2233675

 

prodomImg

pubmed

33

435

S=687 I=38 E=2.8895e-74

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

29

422

S=616 I=34 E=9.39475e-66

MorA

Pubmed 15489433

 

prodomImg

pubmed

35

423

S=574 I=34 E=1.44676e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

32

431

S=573 I=34 E=1.7835e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

40

423

S=573 I=33 E=1.7835e-60

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

15

423

S=572 I=32 E=2.03269e-60

ScrC

Pubmed 12374828

 

prodomImg

pubmed

28

432

S=570 I=30 E=3.90894e-60

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

32

431

S=570 I=34 E=4.01253e-60

PDEA1

Pubmed 15042328

 

prodomImg

pubmed

35

420

S=557 I=34 E=1.52192e-58

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

sp

36

448

S=644 I=35 E=2.8693e-69

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

sp

41

423

S=573 I=34 E=1.12036e-60

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

40

423

S=573 I=33 E=1.13017e-60

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

29

427

S=569 I=34 E=3.21754e-60

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

sp

25

444

S=512 I=30 E=2.80664e-53

Uncharacterized protein Mb1389c - Mycobacterium bovis

 

prodomImg

Iprscan [PD000039]

447

563

-

Iprscan [G3DSA:3.30.70.270]

25

176

-

Iprscan [G3DSA:3.40.50.2300]

443

570

-

Iprscan [PTHR23283]

22

567

-

Iprscan [PTHR23283:SF21]

22

567

-

Iprscan IPR001789 [PF00072]

446

559

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PF00563]

178

419

EAL

Iprscan IPR000160 [PF00990]

24

164

GGDEF

Iprscan IPR001633 [SM00052]

178

424

EAL

Iprscan IPR000160 [SM00267]

11

168

GGDEF

Iprscan IPR001789 [SM00448]

446

558

Signal transduction response regulator, receiver region

Iprscan IPR000160 [TIGR00254]

10

169

GGDEF

Iprscan IPR000595 [PS50042]

465

520

Cyclic nucleotide-binding

Iprscan IPR001789 [PS50110]

447

562

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PS50883]

179

433

EAL

Iprscan IPR000160 [PS50887]

37

170

GGDEF

Iprscan [seg]

372

380

-

Iprscan IPR011006 [SSF52172]

443

570

CheY-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uea8RZJj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

194 hits
swiss-prot

Swiss-Prot ncbi-blastp

86 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

28 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits