Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1911NP_637276.1GGDEF family protein

XCC1911
XCC1910
XCC1910
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1912
XCC1912
ID
AC NP_637276.1
LT XCC1911
SY
OR NC_003902 from 2237946 to 2240036 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE GGDEF family protein
IP MHYT; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO
PM
AN
SQ 696 aa
 
........10........20........30........40........50
| | | | |
MLGTYNLSLVLLSLAVAVLASYTALHLAARMTASRGGIAAAWLVGGAIAM
GFGIWSMHFVGMLAFQLPIPLGYDLALTAYSMLVAILASALALWLTSRAD
LPWRRLSLGALLMGLGIALMHYMGMAAMRMDPEITYDPLLFAVSVAIAIG
ASAAGLWIAFQLRHDGRRYSLRVVAAMIMGVAIVGMHYTGMAAAQFAPGS
ICGAAGIGAQLPLSWLASVVAAVTLGLLGLALVISVLSRRFQQRTDVLAQ
SLAQANQELVLAALHDPLTRLPNRVLLHEHVLQSIERGQRDGQRFAVMLI
DLDGFKAVNDGYGHQLGDQLLIAVAQRLGAHRRAHGSLARLGADEFVLVA
DIADPEDAAAIAGHLVQALALPFLVGDHELRLSSSVGIALYPEDAGSEHQ
LMTHADAAMGHAKQAGRNRYSFFDRSMTGTTRERLQLLQDLPRALELGQF
ALHYQPKYCAEDGRPLGAEALIRWLHPERGMVPPDSFIPLAERSGMIGPL
GKWVLEEACRQMRAWRDAGHGDWRVAVNLSATQLASPSLPAEVAATLAAH
AIAPGQLTLEITETMAMRDADACLRTLGQLTDLGVRIAIDDFGTGYSNLL
YLRKLPAHELKIDRSFVQAMDSGPEDIAIVAAVVALAHTMRLQVVAEGVE
TPAQRNTLERLGCDQLQGYLLGRPMEPDRFIALVVAQRDGERRRAS
xansp

NP_637230.1 lcl|pdeA-XCC1865

243

675

S=741 I=38 E=6.6554e-83

c-di-GMP phosphodiesterase A

xansp

NP_637325.2 lcl|XCC1959

254

677

S=709 I=41 E=4.72117e-79

hypothetical protein

xansp

NP_637884.2 lcl|XCC2536

248

687

S=698 I=37 E=1.14792e-77

phosphodiesterase

xansp

NP_637629.1 lcl|XCC2274

248

686

S=677 I=36 E=3.98709e-75

GGDEF family protein

xansp

NP_637323.1 lcl|pdeA-XCC1958

292

675

S=591 I=35 E=9.70597e-65

c-di-GMP phosphodiesterase A

xansp

NP_637143.1 lcl|XCC1777

269

675

S=431 I=31 E=2.1681e-45

hypothetical protein

xansp

NP_639217.1 lcl|XCC3877

430

682

S=415 I=40 E=2.32085e-43

hypothetical protein

xansp

NP_638051.1 lcl|vieA-XCC2703

441

675

S=412 I=42 E=4.42433e-43

response regulator

xansp

NP_637388.1 lcl|XCC2023

448

676

S=394 I=39 E=6.59632e-41

hypothetical protein

xansp

NP_637989.1 lcl|XCC2641

242

681

S=381 I=29 E=2.52383e-39

hypothetical protein

pubmed

263

682

S=856 I=40 E=9.94504e-95

MorA

Pubmed 15489433

 

prodomImg

pubmed

254

687

S=833 I=38 E=7.31124e-92

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

4

196

S=239 I=29 E=6.5337e-20

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

251

675

S=774 I=37 E=8.80553e-85

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

244

683

S=751 I=39 E=5.63061e-82

Multidomain signal-transduction protein

Pubmed 16436438

 

prodomImg

pubmed

248

687

S=750 I=37 E=7.44258e-82

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

246

678

S=743 I=38 E=6.03233e-81

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

266

680

S=729 I=37 E=2.77179e-79

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

263

677

S=695 I=37 E=3.1761e-75

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

263

684

S=695 I=37 E=3.34667e-75

PDEA1

Pubmed 15042328

 

prodomImg

sp

1

684

S=1663 I=49 E=0

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

22

675

S=916 I=35 E=4.14766e-102

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

sp

254

687

S=833 I=38 E=4.60682e-92

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

4

196

S=239 I=29 E=4.11689e-20

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

255

678

S=791 I=42 E=5.55764e-87

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

Iprscan [G3DSA:3.30.70.270]

254

431

-

Iprscan IPR001633 [PF00563]

433

674

EAL

Iprscan IPR000160 [PF00990]

259

419

GGDEF

Iprscan IPR005330 [PF03707]

114

178

MHYT

Iprscan IPR005330 [PF03707]

180

237

MHYT

Iprscan IPR005330 [PF03707]

51

112

MHYT

Iprscan IPR001633 [SM00052]

433

679

EAL

Iprscan IPR000160 [SM00267]

252

423

GGDEF

Iprscan IPR000160 [TIGR00254]

259

424

GGDEF

Iprscan IPR001633 [PS50883]

434

688

EAL

Iprscan IPR000160 [PS50887]

293

425

GGDEF

Iprscan IPR005330 [PS50924]

5

197

MHYT

Iprscan [seg]

106

120

-

Iprscan [seg]

142

155

-

Iprscan [seg]

173

186

-

Iprscan [seg]

216

238

-

Iprscan [seg]

350

362

-

Iprscan [seg]

627

637

-

Iprscan [seg]

7

21

-

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [tmhmm]

106

128

-

Iprscan [tmhmm]

106

128

-

Iprscan [tmhmm]

138

160

-

Iprscan [tmhmm]

138

160

-

Iprscan [tmhmm]

173

195

-

Iprscan [tmhmm]

173

195

-

Iprscan [tmhmm]

215

237

-

Iprscan [tmhmm]

215

237

-

Iprscan [tmhmm]

38

60

-

Iprscan [tmhmm]

38

60

-

Iprscan [tmhmm]

4

26

-

Iprscan [tmhmm]

4

26

-

Iprscan [tmhmm]

75

97

-

Iprscan [tmhmm]

75

97

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one oSPHLRvD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

130 hits
swiss-prot

Swiss-Prot ncbi-blastp

81 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

34 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

35 hits