Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1856rpfCNP_637221.1RpfC protein

rpfC XCC1856
XCC1855
XCC1855
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1857
XCC1857
ID rpfC
AC NP_637221.1
LT XCC1856
SY
OR NC_003902 from 2160108 to 2162288 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE RpfC protein
IP ATP-binding region, ATPase-like; Histidine kinase, homodimeric; CheY-like; Aerobic respiration control hybrid signal transduction histidine kinase ArcB
CL
EC
GO Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Biological Process: phosphorylation (GO:0016310)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: ATP binding (GO:0005524)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 726 aa
 
........10........20........30........40........50
| | | | |
MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYQHTHGDTLM
ATWLILVGELLVSLGLMVAILLRPQVSHTRRLIGMLLDYTCTGAIMAIQG
EPASPLYAVCMWVTIGNGLRYGSNYLRAATAMGSLCFLGAILISPYWKAN
PYLSWGLLLGLIAVPLYFDSLLRAMTRAVREARHANQAKSRFLANMSHEF
RTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSLVEEVLDISAI
EAGKIRIDRRDFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKG
DTAHLRQVLLNLVGNAVKFTEHGHVLLRVTRVSGSAEDAVRLRFDVEDTG
IGVPMDMRPRLFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFK
ENQPSGSVFWFELPMAIGEPLKSSTVRVPTGALVDAPEELESSNIIAFSN
PFLRHRARVRSMRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDA
MAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVTPE
AIRACEQAGARAFLAKPVVAAKLLDTLADLAVSTRQLATPATTVQVATSF
EGVLDSSVLDELAALGMGEEFERQFVRQCLDDAQNCVGDIERDGTCSDWE
QLRESAHALRGVASNLGLAQVASSGGELMRMADWQLQAEWRLRLSTLREQ
LKAGKDALDARVQGVKDGECSPRSNE
xansp

NP_638196.1 lcl|XCC2848

141

567

S=535 I=35 E=7.01385e-58

histidine kinase/response regulator hybrid protein

xansp

NP_637714.1 lcl|XCC2360

178

602

S=519 I=33 E=4.98376e-56

two-component system sensor protein

xansp

NP_637714.1 lcl|XCC2360

458

678

S=139 I=27 E=5.32491e-10

two-component system sensor protein

xansp

NP_635875.1 lcl|XCC0483

175

415

S=506 I=43 E=2.2115e-54

two-component system sensor protein

xansp

NP_635875.1 lcl|XCC0483

457

675

S=167 I=25 E=2.72797e-13

two-component system sensor protein

xansp

NP_638194.1 lcl|XCC2846

182

567

S=437 I=34 E=4.22448e-46

histidine kinase/response regulator hybrid protein

xansp

NP_637509.1 lcl|XCC2153

156

567

S=436 I=33 E=6.88363e-46

two-component system sensor protein

xansp

NP_636559.1 lcl|XCC1185

175

567

S=417 I=33 E=1.2325e-43

two-component system sensor protein

xansp

NP_636559.1 lcl|XCC1185

464

567

S=129 I=29 E=1.06874e-08

two-component system sensor protein

pubmed

1

726

S=3753 I=98 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

50

726

S=3478 I=98 E=0

Sensory/regulatory protein rpfC EC=2.7.13.3 ; Cell inner membrane Kinase Phosphoprotein Transcription regulation Transferase Transmembrane Two-

Pubmed 1645442

 

prodomImg

pubmed

50

726

S=3027 I=85 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

pubmed

33

711

S=1982 I=59 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

175

567

S=587 I=37 E=4.80133e-62

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 14660379

 

prodomImg

pubmed

156

533

S=572 I=35 E=3.01962e-60

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12107144

 

prodomImg

pubmed

453

567

S=144 I=26 E=1.97009e-08

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12107144

 

prodomImg

pubmed

175

533

S=570 I=37 E=4.62904e-60

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 16598018

 

prodomImg

pubmed

453

567

S=144 I=26 E=2.09407e-08

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 16598018

 

prodomImg

pubmed

189

545

S=561 I=39 E=5.80199e-59

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12855730

 

prodomImg

sp

50

726

S=3478 I=98 E=0

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris (strain 8004)

Pubmed 1645442,

 

prodomImg

sp

178

433

S=528 I=45 E=4.00976e-55

Sensor protein gacS - Pseudomonas syringae pv. syringae

Pubmed 1314807,

 

prodomImg

sp

460

567

S=168 I=34 E=1.71797e-11

Sensor protein gacS - Pseudomonas syringae pv. syringae

Pubmed 1314807,

 

prodomImg

sp

175

567

S=525 I=33 E=9.50566e-55

Hybrid signal transduction histidine kinase K - Dictyostelium discoideum (Slime mold)

Pubmed 16473345,16765443,

 

prodomImg

sp

176

411

S=515 I=48 E=1.4184e-53

Hybrid signal transduction histidine kinase J - Dictyostelium discoideum (Slime mold)

 

prodomImg

Iprscan [PD000039]

462

567

-

Iprscan IPR004358 [PR00344]

342

356

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

360

370

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

377

395

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

401

414

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR003594 [G3DSA:3.30.565.10]

255

417

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

455

580

-

Iprscan [PTHR23283]

8

586

-

Iprscan [PTHR23283:SF49]

8

586

-

Iprscan IPR001789 [PF00072]

462

578

Signal transduction response regulator, receiver region

Iprscan IPR003661 [PF00512]

188

253

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR008207 [PF01627]

624

700

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003594 [PF02518]

300

416

ATP-binding region, ATPase-like

Iprscan IPR008207 [SM00073]

614

712

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003594 [SM00387]

300

417

ATP-binding region, ATPase-like

Iprscan IPR003661 [SM00388]

188

253

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR001789 [SM00448]

462

577

Signal transduction response regulator, receiver region

Iprscan IPR005467 [PS50109]

195

417

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

463

581

Signal transduction response regulator, receiver region

Iprscan IPR008207 [PS50894]

618

711

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan [seg]

568

582

-

Iprscan [SignalP-NN(euk)]

1

69

-

Iprscan [SignalP-NN(euk)]

1

69

-

Iprscan [tmhmm]

125

147

-

Iprscan [tmhmm]

125

147

-

Iprscan [tmhmm]

152

171

-

Iprscan [tmhmm]

152

171

-

Iprscan [tmhmm]

23

40

-

Iprscan [tmhmm]

23

40

-

Iprscan [tmhmm]

50

72

-

Iprscan [tmhmm]

50

72

-

Iprscan [tmhmm]

93

115

-

Iprscan [tmhmm]

93

115

-

Iprscan IPR008207 [SSF47226]

598

716

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR009082 [SSF47384]

178

249

Signal transduction histidine kinase, homodimeric

Iprscan IPR011006 [SSF52172]

459

581

CheY-like

Iprscan IPR003594 [SSF55874]

242

427

ATP-binding region, ATPase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FEjgQvjF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

999 hits
swiss-prot

Swiss-Prot ncbi-blastp

376 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

59 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

37 hits