Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1723recXNP_637093.1recombination regulator RecX

recX XCC1723
XCC1722
XCC1722
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1724
XCC1724
ID recX
AC NP_637093.1
LT XCC1723
SY
OR NC_003902 from 2001224 to 2001712 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE recombination regulator RecX
IP Regulatory protein RecX
CL
EC
GO Biological Process: regulation of DNA repair (GO:0006282)
PM
AN
SQ 162 aa
 
........10........20........30........40........50
| | | | |
MSEQAPAPKRGRRFKEQTPVQRALGLLVRREHSKKELNRKLQARGIEPEA
AQAAVERLAGEGWQDDVRFAASVVRNRASSGYGPLHIRAELGTHGLDSDA
VSAAMATFEGDWTENALDLIRRRFGEDGPVDLAQRRKAADLLARRGFDGN
SIRLATRFDLED
Hamap RECX_MF_01114 raw_score=1906 norm_score=14.654

Regulatory protein recX [recX].

pubmed

1

162

S=828 I=100 E=3.45029e-92

Regulatory protein recX ; Cytoplasm

Pubmed 12007798

 

prodomImg

pubmed

1

162

S=737 I=88 E=3.76285e-81

Regulatory protein recX ; Cytoplasm

Pubmed 11728720,12007798

 

prodomImg

pubmed

1

162

S=727 I=87 E=6.45532e-80

Regulatory protein recX ; Cytoplasm

Pubmed 11178726

 

prodomImg

pubmed

23

162

S=234 I=40 E=3.33505e-20

Regulatory protein recX ; Cytoplasm

Pubmed 8165147

 

prodomImg

pubmed

23

162

S=233 I=40 E=3.93591e-20

Regulatory protein recX ; Cytoplasm

Pubmed 11053404

 

prodomImg

pubmed

18

152

S=217 I=40 E=3.18745e-18

Regulatory protein recX ; Cytoplasm

Pubmed 8468303

 

prodomImg

pubmed

23

152

S=213 I=35 E=1.22058e-17

Regulatory protein recX ; Cytoplasm

Pubmed 11251842,2121588

 

prodomImg

pubmed

18

133

S=206 I=42 E=8.91023e-17

Regulatory protein recX ; Cytoplasm

Pubmed 8294013,8165147

 

prodomImg

pubmed

20

147

S=172 I=34 E=9.43939e-13

Regulatory protein recX ; Cytoplasm DNA damage repair SOS response

Pubmed 7512687

 

prodomImg

pubmed

22

155

S=153 I=36 E=2.2932e-10

Regulatory protein recX ; Cytoplasm

Pubmed 12718403

 

prodomImg

sp

1

162

S=828 I=100 E=2.20084e-92

Regulatory protein recX - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

162

S=737 I=88 E=2.40021e-81

Regulatory protein recX - Xanthomonas oryzae pv. oryzae

Pubmed 11728720,12007798,

 

prodomImg

sp

1

162

S=734 I=88 E=5.79011e-81

Regulatory protein recX - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

162

S=727 I=87 E=4.11766e-80

Regulatory protein recX - Xanthomonas campestris pv. citri

Pubmed 11178726,

 

prodomImg

sp

1

162

S=727 I=87 E=4.11766e-80

Regulatory protein recX - Xanthomonas axonopodis pv. citri

 

prodomImg

Iprscan IPR003783 [PF02631]

41

161

Regulatory protein RecX

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one L92ku9Sz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

15 hits
swiss-prot

Swiss-Prot ncbi-blastp

102 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

1 hits