Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1581hutINP_636951.2imidazolonepropionase

hutI XCC1581
XCC1579
XCC1579
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1580
XCC1580
ID hutI
AC NP_636951.2
LT XCC1581
SY
OR NC_003902 from 1848578 to 1849783 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE imidazolonepropionase
IP Imidazolonepropionase; Phosphonate metabolism PhnM
CL
EC
GO Biological Process: histidine catabolic process to glutamate and formamide (GO:0019556)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: hydrolase activity (GO:0016787)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)
in cyclic amides (GO:0016812)
PM
AN
SQ 401 aa
 
........10........20........30........40........50
| | | | |
MHCDVLWHNARLMTLDAGDGGLGSVDDGVVACQDGTIVYAGPAADAPPLQ
ASHVHDCQRRWISPGLIDCHTHLVYAGNRANEFEQRLRGASYAQIAAAGG
GIVATVRATRAADDAALLAASLPRLDALLAEGVTTLEIKSGYGLTLEDEI
KQLRVARQLATLRQVEVVPTFLGAHAVPPGAQGQTYIDAVCQEMIPAVAA
QGLAEAVDVFCEHLAFSPAQAEQVFVAARAHGLQIKIHAEQLSNQHGAAL
AARYGALSADHIEYLDQAGIDAMANAGTVAVLLPGAFYFTRDTQLPPIPA
LRAAGVPLALATDCNPGTSPLTSPLLAMNMAATLFRMTVDGCITGFTREA
ARALGRGNRLGRLRAGMQCDLAIWDIDAPADLVYRMGFNPLHTRVWRGHP
C
Hamap HUTI_MF_00372 raw_score=8665 norm_score=41.161

Imidazolonepropionase [hutI].

pubmed

32

399

S=801 I=45 E=2.47816e-88

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Plasmid Zinc

Pubmed 10907845,11273700

 

prodomImg

pubmed

6

399

S=797 I=45 E=7.83335e-88

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Plasmid Zinc

Pubmed 11481431

 

prodomImg

pubmed

34

397

S=779 I=46 E=1.17812e-85

Imidazolonepropionase EC=3.5.2.7 ; Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17564599

 

prodomImg

pubmed

37

387

S=677 I=41 E=2.74103e-73

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17344419

 

prodomImg

pubmed

60

400

S=458 I=32 E=8.85594e-47

HutI ; Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 11133460,15240299

 

prodomImg

pubmed

37

398

S=434 I=30 E=8.60572e-44

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 7704263

 

prodomImg

pubmed

33

347

S=412 I=32 E=3.04162e-41

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17592475

 

prodomImg

pubmed

32

347

S=401 I=31 E=6.83734e-40

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17107561

 

prodomImg

pubmed

33

397

S=400 I=34 E=1.03004e-39

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17369815

 

prodomImg

pubmed

62

387

S=342 I=28 E=9.97597e-33

Probable imidazolonepropionase EC=3.5.2.7 ; Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17615350

 

prodomImg

sp

1

401

S=1583 I=78 E=0

Imidazolonepropionase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

401

S=1345 I=69 E=1.96083e-154

Imidazolonepropionase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

401

S=1339 I=69 E=9.25632e-154

Imidazolonepropionase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

401

S=1313 I=68 E=1.64157e-150

Imidazolonepropionase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

401

S=1272 I=68 E=1.3973e-145

Imidazolonepropionase - Xanthomonas axonopodis pv. citri

 

prodomImg

Iprscan [G3DSA:3.20.20.140]

65

358

-

Iprscan [PTHR22642]

26

398

-

Iprscan IPR006680 [PF01979]

61

375

Amidohydrolase 1

Iprscan IPR005920 [TIGR01224]

25

400

Imidazolonepropionase

Iprscan [seg]

15

31

-

Iprscan [seg]

247

259

-

Iprscan [seg]

350

366

-

Iprscan [seg]

88

130

-

Iprscan IPR011059 [SSF51338]

1

401

Metal-dependent hydrolase, composite

Iprscan [SSF51556]

65

359

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lY1qDMfU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

24 hits
swiss-prot

Swiss-Prot ncbi-blastp

214 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

10 hits