Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1485ldpNP_636857.1dihydrolipoamide dehydrogenase

ldp XCC1485
XCC1484
XCC1484
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1486
XCC1486
ID ldp
AC NP_636857.1
LT XCC1485
SY
OR NC_003902 from 1735807 to 1737243 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE dihydrolipoamide dehydrogenase
IP Mercuric reductase; Glutathione reductase;
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: dihydrolipoyl dehydrogenase activity (GO:0004148)
PM
AN
SQ 478 aa
 
........10........20........30........40........50
| | | | |
MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAAIGKDGKPALGGTCL
RVGCIPSKALLDSSRQFWNMGHLFGDHGISFNDAKMDVPTMIGRKDKIVK
QFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIELKGTNVILA
AGSESIELPFAKFDGDTIVDNVGGLDFTAVPKRMAVIGAGVIGLELGSVW
KRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIKLGAKVSKTEI
TGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLADGTGVKLT
ERGQIEVDGHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPG
HVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFSGSADDLAR
ICHAHPTLSEAIHDAAMAVSKRAIHKAN
xansp

NP_635936.1 lcl|lpdA-XCC0544

4

466

S=779 I=39 E=1.16297e-87

dihydrolipoamide dehydrogenase

xansp

NP_639231.1 lcl|XCC3891

2

460

S=459 I=27 E=5.70266e-49

mercuric reductase

xansp

NP_637927.1 lcl|XCC2579

21

462

S=247 I=22 E=3.11137e-23

reductase

xansp

NP_636224.1 lcl|ahpF-XCC0833

182

328

S=108 I=35 E=2.0362e-06

alkyl hydroperoxide reductase subunit F

pubmed

1

478

S=1414 I=60 E=1.63348e-162

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 2515251,8487301

 

prodomImg

pubmed

1

478

S=1390 I=59 E=1.46754e-159

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; Cytoplasm FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 1902462,2914869

 

prodomImg

pubmed

1

478

S=1375 I=59 E=8.91318e-158

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 2832161,2404760

 

prodomImg

pubmed

1

475

S=1288 I=54 E=2.91848e-147

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 8867378

 

prodomImg

pubmed

5

475

S=1136 I=50 E=8.04335e-129

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 15585501

 

prodomImg

pubmed

4

475

S=1135 I=50 E=1.14996e-128

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein NAD Oxidoreductase Redox-active center

Pubmed 15014069

 

prodomImg

pubmed

4

475

S=1093 I=48 E=1.43654e-123

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 12634329

 

prodomImg

pubmed

4

475

S=1052 I=48 E=1.09175e-118

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein NAD Oxidoreductase Redox-active center

Pubmed 15003488

 

prodomImg

pubmed

2

475

S=1050 I=46 E=2.45623e-118

Dihydrolipoyl dehydrogenase 2, mitochondrial EC=1.8.1.4 ; Alternative splicing FAD Flavoprotein Mitochondrion NAD Oxidoreductase Redox-active

Pubmed 11598235

 

prodomImg

pubmed

2

475

S=1049 I=46 E=2.61081e-118

Dihydrolipoyl dehydrogenase 1, mitochondrial EC=1.8.1.4 ; FAD Flavoprotein Mitochondrion NAD Oxidoreductase Redox-active center Transit pepti

Pubmed 11598235

 

prodomImg

sp

1

478

S=1414 I=60 E=1.03556e-162

Dihydrolipoyl dehydrogenase - Pseudomonas fluorescens

Pubmed 2515251,8487301,

 

prodomImg

sp

1

478

S=1413 I=60 E=1.41739e-162

Dihydrolipoamide dehydrogenase - Pseudomonas aeruginosa

 

prodomImg

sp

1

478

S=1390 I=59 E=9.30356e-160

Dihydrolipoamide dehydrogenase - Pseudomonas putida

Pubmed 1902462,2914869,

 

prodomImg

sp

1

478

S=1375 I=59 E=5.65058e-158

Dihydrolipoyl dehydrogenase - Azotobacter vinelandii

Pubmed 2832161,2404760,1880807,

 

prodomImg

sp

1

475

S=1288 I=54 E=1.8502e-147

Dihydrolipoyl dehydrogenase - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Pubmed 8867378,

 

prodomImg

Iprscan [PD000139]

152

223

-

Iprscan IPR013027 [PR00368]

147

156

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

183

208

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

275

289

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

318

325

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

6

28

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan [PR00411]

147

156

-

Iprscan [PR00411]

183

208

-

Iprscan [PR00411]

275

289

-

Iprscan [PR00411]

318

325

-

Iprscan [PR00411]

353

374

-

Iprscan [PR00411]

418

433

-

Iprscan [PR00411]

440

460

-

Iprscan [PR00411]

45

60

-

Iprscan [PR00411]

6

28

-

Iprscan IPR000815 [PR00945]

16

34

Mercuric reductase

Iprscan IPR000815 [PR00945]

183

200

Mercuric reductase

Iprscan IPR000815 [PR00945]

203

218

Mercuric reductase

Iprscan IPR000815 [PR00945]

389

409

Mercuric reductase

Iprscan IPR004099 [G3DSA:3.30.390.30]

356

475

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan [G3DSA:3.50.50.60]

4

357

-

Iprscan [PTHR22912]

8

474

-

Iprscan IPR006258 [PTHR22912:SF20]

8

474

Dihydrolipoamide dehydrogenase

Iprscan IPR001327 [PF00070]

183

282

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR004099 [PF02852]

357

466

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR013027 [PF07992]

6

329

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR006258 [TIGR01350]

4

476

Dihydrolipoamide dehydrogenase

Iprscan IPR012999 [PS00076]

46

56

Pyridine nucleotide-disulphide oxidoreductase, class I, active site

Iprscan [SSF51905]

4

319

-

Iprscan IPR016156 [SSF55424]

354

475

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kTeTNwAI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

412 hits
swiss-prot

Swiss-Prot ncbi-blastp

226 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

30 hits