Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1469smpANP_636841.1outer membrane protein

smpA XCC1469
XCC1468
XCC1468
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1470
XCC1470
ID smpA
AC NP_636841.1
LT XCC1469
SY
OR NC_003902 from 1715632 to 1716027 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE outer membrane protein
IP SmpA/OmlA
CL
EC
GO Cellular Component: outer membrane (GO:0019867)
PM
AN
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MRNLLLVAAVALSTAGCGIIYKQPIYQGNLIKQTAVEQLQVGQSKQQVSA
LLGTPSIPDPFHAQRWDYTSTQRVDRLARTDVKNFTVFFENEQVVRWEGD
YFPAQDEQLAKSAPKQFGRNLARDKKKQRGR
pubmed

1

131

S=580 I=84 E=2.39753e-62

Outer membrane lipoprotein A

Pubmed 10548726

 

prodomImg

pubmed

21

110

S=168 I=37 E=1.88166e-12

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

21

99

S=161 I=39 E=1.44738e-11

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

13

109

S=158 I=35 E=2.78337e-11

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

pubmed

20

104

S=143 I=35 E=2.15793e-09

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

sp

13

109

S=158 I=35 E=1.80051e-11

Outer membrane lipoprotein omlA precursor - Pseudomonas fluorescens

Pubmed 9973334,

 

prodomImg

sp

20

104

S=143 I=35 E=1.39592e-09

Outer membrane lipoprotein omlA precursor - Pseudomonas aeruginosa

Pubmed 9973334,

 

prodomImg

sp

13

95

S=131 I=38 E=4.00558e-08

Small protein A homolog precursor - Haemophilus influenzae

 

prodomImg

sp

14

68

S=120 I=41 E=7.56341e-07

Small protein A precursor - Shigella flexneri

 

prodomImg

sp

14

68

S=120 I=41 E=7.56341e-07

Small protein A precursor - Escherichia coli (strain K12)

Pubmed 2045357,

 

prodomImg

Iprscan IPR007450 [PF04355]

17

99

SmpA/OmlA

Iprscan [PS51257]

1

17

-

Iprscan [seg]

4

12

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [tmhmm]

4

21

-

Iprscan [tmhmm]

4

21

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fLiC7L4U)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits