Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1248NP_636622.1IS1479 transposase

XCC1248
XCC1247
XCC1247
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1249
XCC1249
ID
AC NP_636622.1
LT XCC1248
SY
OR NC_003902 from 1454806 to 1455786 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE IS1479 transposase
IP Transposase, IS4-like
CL
EC
GO DNA-mediated (GO:0006313)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transposase activity (GO:0004803)
PM
AN
SQ 326 aa
 
........10........20........30........40........50
| | | | |
MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLVAPHYPVSGRPG
RQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPD
ETTILNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPS
STKNADHARDPEMHQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVA
DVTVTHTLLHGKEDSVFGDSGYTGADNREELQDCKAAFFIAARRSTLQAI
GNKRERAREQRWEHFKASVRAKVEHPFRVIKRQFGYTKVRYRGLAKNTAQ
VLTLFALSNLWMKRKQLLPAMGSVRL
xansp

NP_638931.1 lcl|XCC3585

1

326

S=1725 I=98 E=0

IS1479 transposase

xansp

NP_638649.1 lcl|XCC3303

1

326

S=1725 I=98 E=0

IS1479 transposase

xansp

NP_636979.1 lcl|XCC1609

1

326

S=1725 I=98 E=0

IS1479 transposase

xansp

NP_635522.1 lcl|XCC0127

1

326

S=1725 I=98 E=0

IS1479 transposase

xansp

NP_638057.1 lcl|XCC2709

1

326

S=1722 I=98 E=0

IS1479 transposase

xansp

NP_637822.1 lcl|XCC2470

1

326

S=1713 I=98 E=0

IS1479 transposase

xansp

NP_635820.1 lcl|XCC0426

1

62

S=282 I=84 E=1.31629e-27

IS1479 transposase

xansp

NP_639518.1 lcl|XCC4184

1

66

S=280 I=76 E=2.29979e-27

IS1479 transposase

xansp

NP_636001.1 lcl|XCC0609

269

326

S=256 I=83 E=1.82873e-24

IS1479 transposase

xansp

NP_639519.1 lcl|XCC4185

279

322

S=193 I=86 E=6.84164e-17

IS1479 transposase

pubmed

1

322

S=1593 I=91 E=0

Putative transposase

Pubmed 10940020

 

prodomImg

pubmed

2

325

S=1078 I=65 E=5.91365e-122

IS2000 transposase (Transposase)

Pubmed 10427724,10049269

 

prodomImg

pubmed

2

326

S=1054 I=64 E=4.86928e-119

DDE-type transposase

Pubmed 18487340

 

prodomImg

pubmed

2

326

S=1053 I=64 E=5.50143e-119

Transposase ; Plasmid

Pubmed 12547188,15466034

 

prodomImg

pubmed

2

326

S=1051 I=64 E=1.00403e-118

Transposase ; Plasmid

Pubmed 11371531,9244273

 

prodomImg

pubmed

2

326

S=1051 I=64 E=1.00403e-118

Transposase ; Plasmid

Pubmed 12177326,15288784

 

prodomImg

pubmed

2

326

S=1048 I=63 E=2.57447e-118

DDE-type transposase

Pubmed 15941993

 

prodomImg

pubmed

2

326

S=1047 I=63 E=2.71273e-118

Transposase like protein TnpA1

Pubmed 10433976

 

prodomImg

pubmed

2

326

S=1047 I=63 E=3.14613e-118

Transposase-like protein TnpA3

Pubmed 9765796,11133479

 

prodomImg

pubmed

2

326

S=1046 I=63 E=3.77827e-118

Transposase

Pubmed 11371531,9244273

 

prodomImg

sp

2

311

S=881 I=54 E=2.57642e-98

Transposase insH for insertion sequence element IS5Y - Escherichia coli (strain K12)

 

prodomImg

sp

2

311

S=873 I=54 E=2.25869e-97

Transposase insH for insertion sequence element IS5 - Escherichia coli (strain K12)

Pubmed 6269959,6269958,8041620,

 

prodomImg

sp

104

300

S=141 I=28 E=1.00812e-08

Transposase for insertion sequence element IS1106 - Neisseria meningitidis serogroup B

Pubmed 1320728,

 

prodomImg

Iprscan IPR002559 [PF01609]

138

312

Transposase, IS4-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1qnsyPwv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

71 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

10 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits