Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1227hrcQNP_636601.1HrcQ protein

hrcQ XCC1227
XCC1226
XCC1226
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1228
XCC1228
ID hrcQ
AC NP_636601.1
LT XCC1227
SY
OR NC_003902 from 1433525 to 1434439 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE HrcQ protein
IP Type III secretion system apparatus protein YscQ/HrcQ
CL
EC
GO Biological Process: protein secretion by the type III secretion system (GO:0030254)
PM
AN
SQ 304 aa
 
........10........20........30........40........50
| | | | |
MLCDPRAAQRCGYTAQRRGIRAADAARLQLQFDSGSLELRIAARDGLALL
LNEADDALRVAIAGVLLSDDLRALEPLGLGAAEVVAFERCADAVDRLDIG
ITLGGIDAIAETASPLLLAALQTASAALAQPSPLPAWLSALRVTTRLRIG
QRTATAALLQSLRPGDVLLHALATAPVRSGELLWGIPGGAVLRAPVRLTL
QQMILETAPTMQHDMPASDSSSSATDVAALELPVQLEVDQLALSLSVLSG
LQPGQILELSVPVDQADIRLVVYGQTIGIGRLLAVGEHLGVQILSMSETA
HADA
pubmed

1

304

S=851 I=62 E=1.59614e-94

HrcQ

Pubmed 16957248

 

prodomImg

pubmed

1

304

S=850 I=62 E=1.85115e-94

HrcQ homolog

Pubmed 10478481

 

prodomImg

pubmed

1

304

S=850 I=62 E=1.85115e-94

HrcQ

Pubmed 12730176

 

prodomImg

pubmed

1

304

S=836 I=61 E=1.02149e-92

HrcQ

Pubmed 11410350

 

prodomImg

pubmed

1

304

S=831 I=61 E=4.01528e-92

HrcQ

Pubmed 15812033,18326683

 

prodomImg

pubmed

37

304

S=757 I=63 E=4.31053e-83

HrcQ

Pubmed 9781876,11844763

 

prodomImg

pubmed

147

298

S=205 I=37 E=2.68212e-16

SctQ

Pubmed 10403415,11990489

 

prodomImg

pubmed

146

303

S=160 I=32 E=7.87394e-11

HrpQ protein (Hrp conserved protein hrcq)

Pubmed 1479894,1472716

 

prodomImg

pubmed

198

300

S=137 I=32 E=4.82014e-08

BcscQ

Pubmed 11557147

 

prodomImg

pubmed

37

110

S=135 I=50 E=7.78606e-08

Pathogenicity protein

Pubmed 1312532

 

prodomImg

sp

231

298

S=110 I=39 E=6.03582e-05

Yop proteins translocation protein Q - Yersinia pseudotuberculosis

Pubmed 8169210,

 

prodomImg

sp

231

298

S=110 I=39 E=6.03582e-05

Yop proteins translocation protein Q - Yersinia pestis

Pubmed 8300512,9746557,9748454,

 

prodomImg

Iprscan [PD001777]

232

299

-

Iprscan IPR001543 [PF01052]

223

300

Surface presentation of antigens (SPOA) protein

Iprscan IPR013385 [TIGR02551]

33

296

Type III secretion system apparatus protein YscQ/HrcQ

Iprscan [seg]

112

141

-

Iprscan [seg]

217

229

-

Iprscan [seg]

45

58

-

Iprscan IPR001543 [SSF101801]

221

301

Surface presentation of antigens (SPOA) protein

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eztZ4kvg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

15 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits