Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC1156lspANP_636531.1lipoprotein signal peptidase

lspA XCC1156
XCC1155
XCC1155
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC1157
XCC1157
ID lspA
AC NP_636531.1
LT XCC1156
SY
OR NC_003902 from 1346313 to 1346816 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE lipoprotein signal peptidase
IP Peptidase A8, signal peptidase II
CL
EC
GO Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)
Molecular Function: aspartic-type endopeptidase activity (GO:0004190)
PM
AN
SQ 167 aa
 
........10........20........30........40........50
| | | | |
MSQRPNPSALIWLLLSAVVIGLDQWSKAWVLSSLPEYTPVPVIDGFWNWY
RTYNTGAAFSFLSDAGGWQLWFFTALAVGISGLLAFWLSRTARGDWRSAV
PYALVIGGAIGNVIDRLMHGHVVDFIQWYVGEHTWPSFNIADSAIVGGAI
GIALFGLFDGKRSRKAG
Hamap LSPA_MF_00161 raw_score=2234 norm_score=16.172

Lipoprotein signal peptidase [lspA].

pubmed

1

165

S=312 I=43 E=1.05106e-29

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 6378662,6374664

 

prodomImg

pubmed

1

166

S=289 I=41 E=8.35776e-27

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 2403548

 

prodomImg

pubmed

22

163

S=286 I=48 E=1.88033e-26

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 2121716

 

prodomImg

pubmed

13

150

S=264 I=42 E=7.70767e-24

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 17468768

 

prodomImg

pubmed

1

150

S=243 I=39 E=3.02468e-21

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell membrane Hydrolase Plasmid Transmembrane

Pubmed 12534468,12426347

 

prodomImg

pubmed

1

150

S=242 I=39 E=4.06837e-21

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell membrane Hydrolase Plasmid Transmembrane

Pubmed 15246534

 

prodomImg

pubmed

11

164

S=222 I=35 E=1.06905e-18

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell membrane Hydrolase Transmembrane

Pubmed 7729667

 

prodomImg

pubmed

10

165

S=215 I=31 E=7.47115e-18

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell membrane Hydrolase Transmembrane

Pubmed 9141696

 

prodomImg

pubmed

12

152

S=213 I=44 E=1.06816e-17

PbrB/pbrC lead resistance fusion protein (Signal peptidase II. Aspartic peptidase. MEROPS family A08) EC=3.4.23.36 ; Aspartyl protease

Pubmed 7766206,11544228

 

prodomImg

pubmed

54

140

S=191 I=49 E=4.99023e-15

LspA ; Aspartyl protease Cell membrane Hydrolase Transmembrane

Pubmed 16380199

 

prodomImg

sp

1

167

S=849 I=100 E=6.14592e-95

Lipoprotein signal peptidase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

167

S=794 I=92 E=3.46677e-88

Lipoprotein signal peptidase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

166

S=781 I=92 E=1.1437e-86

Lipoprotein signal peptidase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

166

S=781 I=92 E=1.1437e-86

Lipoprotein signal peptidase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

167

S=727 I=91 E=3.92484e-80

Lipoprotein signal peptidase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

Iprscan [PD004304]

40

162

-

Iprscan IPR001872 [PR00781]

102

117

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PR00781]

138

154

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PR00781]

54

62

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PF01252]

10

165

Peptidase A8, signal peptidase II

Iprscan IPR001872 [TIGR00077]

1

166

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PS00855]

105

117

Peptidase A8, signal peptidase II

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [tmhmm]

138

158

-

Iprscan [tmhmm]

138

158

-

Iprscan [tmhmm]

67

89

-

Iprscan [tmhmm]

67

89

-

Iprscan [tmhmm]

7

26

-

Iprscan [tmhmm]

7

26

-

Iprscan [tmhmm]

96

118

-

Iprscan [tmhmm]

96

118

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9sF27f5A)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

272 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

17 hits