Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0992opsXNP_636369.1saccharide biosynthesis regulatory protein

opsX XCC0992
XCC0991
XCC0991
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0993
XCC0993
ID opsX
AC NP_636369.1
LT XCC0992
SY
OR NC_003902 from 1144873 to 1145919 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE saccharide biosynthesis regulatory protein
IP Glycosyl transferase, family 9
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: transferase activity (GO:0016740)
PM
AN
SQ 348 aa
 
........10........20........30........40........50
| | | | |
MASTPASLCLLRLSALGDVTHVVPLVHTLQAGFPQAQLHWIIDKAGLKLL
DGLPGVQFHAYDKRSGLAGMRAVRQSLAAHGHFDALLQMQVAFRANVLSA
FVPARRRIGYDRSRSKDLHGLFVNERIADRPCIHVLDAIGSFAEPLGLRQ
TEVRWNLPVPADAHAWAQAQWQDDGRPVLMISPCSSHVRRNWYPDRHAAL
ADHAAAQGWRVVLCGGRSGLERSTADAIIAAARTPVLDLVGKDTLKQLPA
LLARAALVVTPDSGPMHIANAMGTKVLGLHAASNPRRSGPYSDVRYCVDR
YDDAARKHLGKPAAQLKWGTKIEFEDVMTLISVDDAIAAFERYRADHH
pubmed

70

347

S=1063 I=75 E=3.76697e-120

DNA, complete cds

Pubmed 8376331

 

prodomImg

pubmed

3

348

S=593 I=36 E=3.26338e-63

WaaC

Pubmed 18310345

 

prodomImg

pubmed

102

342

S=380 I=32 E=2.19492e-37

Lipopolysaccharide biosynthesis protein

Pubmed 17185550

 

prodomImg

pubmed

102

247

S=193 I=31 E=9.99689e-15

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

247

S=192 I=30 E=1.39236e-14

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

247

S=191 I=30 E=1.53251e-14

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

247

S=189 I=29 E=2.67756e-14

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

247

S=189 I=29 E=2.77259e-14

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

247

S=188 I=29 E=3.9987e-14

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

247

S=188 I=30 E=4.43974e-14

Heptosyl transferase

Pubmed 12797973

 

prodomImg

sp

1

342

S=598 I=35 E=5.50747e-64

Putative glycosyltransferase HI0261 - Haemophilus influenzae

 

prodomImg

sp

17

308

S=137 I=20 E=3.64426e-08

Lipopolysaccharide core biosynthesis glycosyltransferase rfaQ - Escherichia coli (strain K12)

Pubmed 1732225,1447141,8041620,

 

prodomImg

Iprscan [G3DSA:3.40.50.2000]

159

341

-

Iprscan [G3DSA:3.40.50.2000]

7

111

-

Iprscan IPR002201 [PF01075]

70

319

Glycosyl transferase, family 9

Iprscan [seg]

161

174

-

Iprscan [seg]

197

206

-

Iprscan [seg]

248

257

-

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [SSF53756]

7

342

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one o2hwBCuM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

29 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits