Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0934NP_636320.1oxidoreductase

XCC0934
XCC0933
XCC0933
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0935
XCC0935
ID
AC NP_636320.1
LT XCC0934
SY
OR NC_003902 from 1086920 to 1087942 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 340 aa
 
........10........20........30........40........50
| | | | |
MKAVALTHYLPIDDPASLLDMDLPAPSAPAGYDLLVRVEAVSVNPVDTKL
RAPKAQTLAAPKVLGFDAAGVVEAVGPDVTAFAVGDEVYYAGDSGRQGSN
AEYHLVDARIAGCKPTSLSFAQAAAMPLTTLTAWELLFQRMPFAFDGARN
RGKHLLIIGGAGGVGSIAIQLARHAGFTVIATASRPETVEWVRQMGAQHV
IDHHQPLHPQLQAIGLDQVDAALNLADTDRYWAQLGELLAPQGHVGLIVE
PRGPLPIGDPYKSKCIGIHWELMFTRARYATDDMVEQHRILNRAASLIDA
GELRTTHTETLSPICAQTLREAHRRLESGSTIGKLVVAGW
xansp

NP_639550.1 lcl|XCC4216

1

340

S=787 I=51 E=7.2724e-89

bifunctional oxidoreductase/alginate lyase

xansp

NP_638078.1 lcl|XCC2730

16

205

S=139 I=30 E=2.32963e-10

alcohol dehydrogenase

xansp

NP_636133.1 lcl|XCC0742

29

337

S=137 I=30 E=4.97407e-10

quinone reductase

xansp

NP_639049.1 lcl|ybdR-XCC3703

33

88

S=95 I=43 E=5.45193e-05

Zn-dependent alcohol dehydrogenase

pubmed

1

340

S=754 I=49 E=1.01573e-82

Putative zinc-binding dehydrogenase

Pubmed 15574953

 

prodomImg

pubmed

28

337

S=568 I=40 E=4.02383e-60

Zinc-type alcohol dehydrogenase-like protein SA1988 ; Metal-binding Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

22

337

S=277 I=31 E=7.00876e-25

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

24

337

S=254 I=33 E=3.60395e-22

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

29

200

S=231 I=37 E=2.6495e-19

Glycosyl hydrolase

Pubmed 17086451

 

prodomImg

pubmed

19

257

S=219 I=31 E=6.22126e-18

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

19

257

S=207 I=30 E=1.76969e-16

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

22

257

S=205 I=31 E=3.258e-16

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

pubmed

1

257

S=204 I=29 E=4.49834e-16

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 7476124

 

prodomImg

pubmed

34

205

S=202 I=37 E=7.59001e-16

Quinone oxidoreductase

Pubmed 16517758

 

prodomImg

sp

1

337

S=587 I=36 E=1.06127e-62

Zinc-type alcohol dehydrogenase-like protein SERP1785 - Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

 

prodomImg

sp

1

337

S=584 I=36 E=2.69762e-62

Zinc-type alcohol dehydrogenase-like protein SE_1777 - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

sp

28

337

S=575 I=40 E=3.0453e-61

Zinc-type alcohol dehydrogenase-like protein MW2112 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

28

337

S=575 I=40 E=3.0453e-61

Zinc-type alcohol dehydrogenase-like protein SAS2087 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

sp

28

337

S=575 I=41 E=3.32273e-61

Zinc-type alcohol dehydrogenase-like protein SACOL2177 - Staphylococcus aureus (strain COL)

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

7

184

-

Iprscan IPR002085 [PTHR11695]

18

337

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF34]

18

337

-

Iprscan IPR013149 [PF00107]

151

286

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

31

109

Alcohol dehydrogenase GroES-like

Iprscan IPR014182 [TIGR02817]

2

340

Alcohol dehydrogenase, zinc-binding type 1

Iprscan IPR002364 [PS01162]

152

173

Quinone oxidoreductase/zeta-crystallin, conserved site

Iprscan [seg]

157

169

-

Iprscan IPR011032 [SSF50129]

1

159

GroES-like

Iprscan IPR016040 [SSF51735]

122

309

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one c1tgs3M1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

133 hits
swiss-prot

Swiss-Prot ncbi-blastp

40 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits