Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0928mdhNP_636314.1malate dehydrogenase

mdh XCC0928
XCC0927
XCC0927
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0929
XCC0929
ID mdh
AC NP_636314.1
LT XCC0928
SY
OR NC_003902 from 1078772 to 1079758 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE malate dehydrogenase
IP Lactate/malate dehydrogenase;
CL
EC
GO Biological Process: malate metabolic process (GO:0006108)
Biological Process: metabolic process (GO:0008152)
Biological Process: glycolysis (GO:0006096)
Biological Process: cellular carbohydrate metabolic process (GO:0044262)
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: malate dehydrogenase activity (GO:0016615)
Molecular Function: catalytic activity (GO:0003824)
NAD or NADP as acceptor (GO:0016616)
PM
AN
SQ 328 aa
 
........10........20........30........40........50
| | | | |
MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELSNEKAQA
ALKGVMMELEDCAFPLLAGMVGTDDAEVAFKDIDVALLVGARPRGPGMER
KDLLLENAKIFTAQGAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLN
PKNFTAMLRLDHNRALSQLSLKLGKPVGGIEKLVVWGNHSPTMYPDYRFA
TSDGASIGDAINDQEWNAGTFIPTVGKRGAAIIEARGLSSAASAANAAID
HVRDWVLGSNGKWVTMGVPSDGSYGIPEGVIFGFPVTTENGQYTLVKDLP
IDDFSQKYIDKTLAELEEERSGVSHLLG
Hamap MDH_MF_01517 raw_score=11070 norm_score=55.078

Malate dehydrogenase [mdh].

pubmed

1

327

S=1293 I=75 E=4.53215e-148

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17344419

 

prodomImg

pubmed

2

328

S=1277 I=73 E=3.90129e-146

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 10206992

 

prodomImg

pubmed

6

327

S=1254 I=75 E=2.28635e-143

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 9190829

 

prodomImg

pubmed

2

328

S=1239 I=73 E=1.86779e-141

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 12113928,16133321

 

prodomImg

pubmed

2

327

S=1202 I=69 E=4.60972e-137

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 8900056

 

prodomImg

pubmed

1

326

S=1020 I=62 E=6.52723e-115

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 3771528,2034208

 

prodomImg

pubmed

1

326

S=914 I=55 E=4.43807e-102

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17194220

 

prodomImg

pubmed

2

326

S=912 I=57 E=6.6859e-102

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17369815

 

prodomImg

pubmed

1

328

S=853 I=50 E=1.03689e-94

Malate dehydrogenase, cytoplasmic EC=1.1.1.37 ; Acetylation NAD Oxidoreductase Phosphoprotein Tricarboxylic acid cycle

Pubmed 8786100

 

prodomImg

pubmed

1

320

S=850 I=52 E=2.19469e-94

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 12612830

 

prodomImg

sp

1

328

S=1659 I=97 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

328

S=1641 I=96 E=0

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

328

S=1641 I=96 E=0

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

328

S=1582 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

328

S=1580 I=91 E=0

Malate dehydrogenase - Xanthomonas axonopodis pv. citri

 

prodomImg

Iprscan [PD003052]

261

320

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

156

NAD(P)-binding

Iprscan IPR015955 [G3DSA:3.90.110.10]

157

326

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Iprscan IPR001557 [PIRSF000102]

4

322

L-lactate/malate dehydrogenase

Iprscan IPR010945 [PTHR23382]

99

327

Malate dehydrogenase, NAD or NADP

Iprscan IPR001236 [PF00056]

5

156

Lactate/malate dehydrogenase

Iprscan IPR001236 [PF02866]

159

327

Lactate/malate dehydrogenase

Iprscan IPR010945 [TIGR01759]

2

323

Malate dehydrogenase, NAD or NADP

Iprscan [seg]

239

248

-

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan IPR016040 [SSF51735]

2

157

NAD(P)-binding

Iprscan IPR015955 [SSF56327]

158

328

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7wywMQ6J)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

124 hits
swiss-prot

Swiss-Prot ncbi-blastp

273 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

13 hits