Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0742NP_636133.1quinone reductase

XCC0742
XCC0741
XCC0741
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0743
XCC0743
ID
AC NP_636133.1
LT XCC0742
SY
OR NC_003902 from 889187 to 890164 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE quinone reductase
IP Alcohol dehydrogenase superfamily, zinc-containing;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 325 aa
 
........10........20........30........40........50
| | | | |
MSETTMTAIAIRNGKGDADALHAVEQARPQPAPGQVLIRVHAAGINRPDL
LQRGGHYPPPPGAPETLGLEVAGEVVVAAGRWKVGDRVCALLGGGGYAQY
AAVDARHVLPVPEGMTLVQAAALPETIFTAYANLFEHGRLAAGEWLLLHG
ATSGIGVTAIQLAKAAGAHVLATARSAGKAAQARELGADVAIDSTTESFV
AAAKAHAGVDVALDMVGASVFADTLEALNPGGRIVYIASQAGATLEVPIP
LLMRKQAIITGSTLRPRNADEKARLAAEVERVVWPWIAQGKVRVLIDQCF
PLAEAAAAHRYLEQGSHLGKVVLEM
xansp

NP_638078.1 lcl|XCC2730

112

325

S=183 I=32 E=1.2868e-15

alcohol dehydrogenase

xansp

NP_639466.1 lcl|XCC4127

3

279

S=150 I=25 E=9.8734e-12

nuclear receptor binding factor related protein

xansp

NP_636320.1 lcl|XCC0934

103

193

S=125 I=39 E=1.05602e-08

oxidoreductase

xansp

NP_635665.1 lcl|XCC0270

128

234

S=122 I=35 E=2.56977e-08

quinone oxidoreductase

pubmed

16

325

S=414 I=33 E=1.5142e-41

Putative quinone oxidoreductase EC=1.-.-.- ; Acetylation Alternative splicing Polymorphism

Pubmed 9305847,15067011

 

prodomImg

pubmed

81

325

S=337 I=32 E=2.86498e-32

NADH:quinone reductase and related Zn-dependent oxidoreductases

Pubmed 15608629

 

prodomImg

pubmed

25

323

S=298 I=32 E=1.67622e-27

Putative NADPH:quinone oxidoreductase GrhO7

Pubmed 12323376

 

prodomImg

pubmed

140

325

S=285 I=41 E=5.98133e-26

Quinone oxidoreductase

Pubmed 11274137

 

prodomImg

pubmed

4

325

S=267 I=32 E=1.10896e-23

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

29

187

S=264 I=37 E=2.38851e-23

Oxidoreductase

Pubmed 17086451

 

prodomImg

pubmed

10

323

S=261 I=30 E=5.14446e-23

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

21

323

S=248 I=30 E=1.7728e-21

ORF326 protein

Pubmed 8300574,10563807

 

prodomImg

pubmed

29

176

S=248 I=43 E=1.96833e-21

Quinone oxidoreductase-like protein

Pubmed 17086451

 

prodomImg

pubmed

15

325

S=247 I=29 E=2.78971e-21

Polyketide synthase ; Phosphopantetheine Transferase

Pubmed 16194230

 

prodomImg

sp

16

325

S=414 I=33 E=9.53952e-42

Putative quinone oxidoreductase - Homo sapiens (Human)

Pubmed 9305847,15067011,17224074,

 

prodomImg

sp

30

323

S=251 I=30 E=5.60879e-22

Quinone oxidoreductase - Pseudomonas aeruginosa

 

prodomImg

sp

29

323

S=248 I=28 E=1.14647e-21

Quinone oxidoreductase - Rattus norvegicus (Rat)

 

prodomImg

sp

29

323

S=247 I=28 E=1.86813e-21

Quinone oxidoreductase - Mus musculus (Mouse)

Pubmed 8170370,8645260,

 

prodomImg

sp

27

325

S=245 I=28 E=2.78988e-21

Quinone oxidoreductase - Cavia porcellus (Guinea pig)

Pubmed 2777081,1420281,1370456,

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

105

300

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

20

325

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan IPR014189 [PTHR11695:SF28]

20

325

Quinone oxidoreductase putative, PIG3

Iprscan IPR013149 [PF00107]

142

281

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

33

111

Alcohol dehydrogenase GroES-like

Iprscan IPR014189 [TIGR02824]

6

325

Quinone oxidoreductase putative, PIG3

Iprscan [seg]

200

212

-

Iprscan [seg]

67

80

-

Iprscan [seg]

90

102

-

Iprscan IPR011032 [SSF50129]

6

146

GroES-like

Iprscan IPR016040 [SSF51735]

119

294

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wA0G7BX4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

266 hits
swiss-prot

Swiss-Prot ncbi-blastp

66 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits