Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0669xpsNNP_636061.1general secretion pathway protein N

xpsN XCC0669
XCC0668
XCC0668
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0670
XCC0670
ID xpsN
AC NP_636061.1
LT XCC0669
SY
OR NC_003902 from 807128 to 807913 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE general secretion pathway protein N
IP
CL
EC
GO
PM
AN
SQ 261 aa
 
........10........20........30........40........50
| | | | |
MRLEMIGLRTWLLATVVGWALLVCVLAVAGLGKRVELLPDDPALVQRLPA
LPAPAPERLGPFEKYAEIAAHPAFAEDRLPHPFFLSGNDGSGAASTVRLT
GVLLTSTFKMATLTLDPADSVRVQLGGDAVKGYRLLALQPRSATIEGPGG
TQTLELQVFNGQGGQPPTAIGGRPQAPGAVPPLPPNVPPAPATPAPPPAE
VPQQQPGGQAPPTVPPQRSDGAQEAPRPSDEQMRAIRERIEARRRQLQQQ
RQGGSTPGQTQ
pubmed

1

261

S=715 I=62 E=3.6033e-78

General secretion pathway protein N ; Cell inner membrane Transmembrane Transport

Pubmed 10692359

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SxE6UQgy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits