Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0626xanANP_636018.1phosphoglucomutase

xanA XCC0626
XCC0625
XCC0625
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0627
XCC0627
ID xanA
AC NP_636018.1
LT XCC0626
SY
OR NC_003902 from 748661 to 750013 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE phosphoglucomutase
IP Phosphoglucomutase/phosphomannomutase; Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I; ;
CL
EC
GO Biological Process: carbohydrate metabolic process (GO:0005975)
phosphotransferases (GO:0016868)
PM
AN
SQ 450 aa
 
........10........20........30........40........50
| | | | |
MPMTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRL
ASPALQEALSAGLRASGREVIDIGLCGTEEVYFQTDHLKAAGGVMVTASH
NPMDYNGMKLVREQARPISSDTGLFAIRDTVAADTAAAGEPTAAEHSRTD
KTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAGLIVDLLAPHLPFEFVRVF
HEPDGNFPNGIPNPLLPENRDATAKAVKEHGADFGIAWDGDFDRCFFFDH
TGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEMVEDAGGIPVL
CKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVS
QSGRSLADLVEARMQKFPCSGEINFKVDDAKAAVARVMAHYGDQSPELDY
TDGISADFGQWRFNLRSSNTEPLLRLNVETRGDAALLETRTQEISNLLRG
xansp

NP_639197.1 lcl|algC-XCC3857

1

441

S=526 I=34 E=5.16177e-57

phosphomannomutase

xansp

NP_637887.1 lcl|mrsA-XCC2539

8

449

S=254 I=28 E=3.89961e-24

phosphohexose mutase

pubmed

3

450

S=2204 I=93 E=0

Phosphohexose mutases EC=5.4.2.2 EC=5.4.2.8 ; Exopolysaccharide synthesis Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosph

Pubmed 1370280,18304669

 

prodomImg

pubmed

3

449

S=1821 I=76 E=0

Phosphoglucomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 12761084

 

prodomImg

pubmed

3

450

S=1691 I=72 E=0

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 16585771

 

prodomImg

pubmed

4

448

S=1384 I=59 E=6.69521e-159

Phosphomannomutase EC=5.4.2.8 ; Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

Pubmed 1383393

 

prodomImg

pubmed

5

449

S=1376 I=58 E=6.8073e-158

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

5

449

S=1375 I=59 E=7.49249e-158

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967,15375135

 

prodomImg

pubmed

5

448

S=1372 I=59 E=1.85534e-157

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

5

448

S=1371 I=59 E=2.24764e-157

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

5

448

S=1371 I=59 E=2.81952e-157

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

5

449

S=1370 I=58 E=3.15791e-157

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

sp

3

450

S=2204 I=93 E=0

Phosphohexose mutases [Includes: Phosphoglucomutase - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 1370280,18304669,

 

prodomImg

sp

4

448

S=1384 I=59 E=4.21437e-159

Phosphomannomutase - Salmonella montevideo

Pubmed 1383393,

 

prodomImg

sp

5

448

S=1363 I=59 E=1.46379e-156

Phosphomannomutase - Salmonella typhimurium

Pubmed 1712067,

 

prodomImg

sp

5

448

S=1333 I=57 E=5.84042e-153

Phosphomannomutase - Escherichia coli (strain K12)

Pubmed 7815923,8759852,

 

prodomImg

sp

4

438

S=1329 I=57 E=1.81422e-152

Phosphomannomutase - Escherichia coli O157:H7

Pubmed 9673232,10222209,

 

prodomImg

Iprscan IPR005841 [PR00509]

169

188

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

203

216

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

232

247

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

92

106

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR016055 [G3DSA:3.40.120.10]

171

248

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [G3DSA:3.40.120.10]

249

361

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [G3DSA:3.40.120.10]

7

121

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan [PTHR22573]

246

441

-

Iprscan [PTHR22573:SF6]

246

441

-

Iprscan IPR005843 [PF00408]

372

450

Alpha-D-phosphohexomutase, C-terminal

Iprscan IPR005844 [PF02878]

5

138

Alpha-D-phosphohexomutase, alpha/beta/alpha domain I

Iprscan IPR005845 [PF02879]

152

254

Alpha-D-phosphohexomutase, alpha/beta/alpha domain II

Iprscan IPR005846 [PF02880]

256

367

Alpha-D-phosphohexomutase, alpha/beta/alpha domain III

Iprscan IPR016066 [PS00710]

93

102

Alpha-D-phosphohexomutase, conserved site

Iprscan IPR016055 [SSF53738]

151

255

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [SSF53738]

2

176

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [SSF53738]

256

363

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan [SSF55957]

365

450

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one g32H7uEl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

184 hits
swiss-prot

Swiss-Prot ncbi-blastp

517 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits