Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0600wzmNP_635992.1membrane subunit of LPS efflux transporter

wzm XCC0600
XCC0599
XCC0599
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0601
XCC0601
ID wzm
AC NP_635992.1
LT XCC0600
SY
OR NC_003902 from 721894 to 722685 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE membrane subunit of LPS efflux transporter
IP ABC-2
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: ATP binding (GO:0005524)
coupled to transmembrane movement of substances (GO:0042626)
PM
AN
SQ 263 aa
 
........10........20........30........40........50
| | | | |
MDMIRSVWAFRYFILSSIRNDLRLRFLRSKLGALWMIIHPLMQVLIFATI
LSEVLAAKLPGVNNKFAYALYLMAGTLCWSMFAESIGKCASLFVDNGNLM
KKQAFPRICLPLIAGGTVMVNNLLLFLAIIVVFAILGHSLGPQAGWLPLL
MLLTLAFAMSIGLLLGIFNVFVRDIGQVVPVVLQAMFWVTPIVYTIDILP
QQTRDLFKLNPLFPLVSAYQGVLLYGRAPDWMSLLPLTAATAVLGFVSLV
VFRRASAEMVDAL
pubmed

3

263

S=1158 I=88 E=8.41684e-132

ABC transporter

Pubmed 11589581

 

prodomImg

pubmed

3

263

S=517 I=36 E=3.92591e-54

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

pubmed

2

263

S=510 I=37 E=2.60382e-53

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

pubmed

3

263

S=508 I=35 E=4.09741e-53

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

pubmed

3

263

S=507 I=35 E=6.44775e-53

Putative integral membrane component of ABC-transporter

Pubmed 7536735,8162191

 

prodomImg

pubmed

3

263

S=501 I=34 E=3.43888e-52

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

pubmed

1

263

S=499 I=40 E=5.31792e-52

Membrane-spanning domain MSD

Pubmed 9244257

 

prodomImg

pubmed

3

263

S=465 I=36 E=7.64407e-48

ABC-transporter protein

Pubmed 11096116,15044388

 

prodomImg

pubmed

50

263

S=401 I=37 E=3.88027e-40

Wzm

Pubmed 10768928

 

prodomImg

pubmed

1

263

S=279 I=23 E=2.87387e-25

Putative ABC transporter system integral membrane protein

Pubmed 9393727,10074083

 

prodomImg

sp

3

263

S=252 I=25 E=3.0563e-22

O-antigen export system permease protein rfbA - Myxococcus xanthus

Pubmed 8626291,

 

prodomImg

sp

19

263

S=234 I=27 E=4.40053e-20

O-antigen export system permease protein rfbA - Klebsiella pneumoniae

Pubmed 8752339,

 

prodomImg

sp

19

263

S=231 I=26 E=1.01627e-19

O-antigen export system permease protein rfbA - Klebsiella pneumoniae

Pubmed 7533882,

 

prodomImg

sp

21

226

S=131 I=22 E=1.22955e-07

Teichoic acid translocation permease protein tagG - Bacillus subtilis

Pubmed 7565096,

 

prodomImg

Iprscan IPR013525 [PF01061]

12

224

ABC-2 type transporter

Iprscan IPR000412 [PS51012]

31

255

ABC-2

Iprscan [SignalP-NN(euk)]

1

56

-

Iprscan [tmhmm]

112

134

-

Iprscan [tmhmm]

149

171

-

Iprscan [tmhmm]

178

200

-

Iprscan [tmhmm]

231

253

-

Iprscan [tmhmm]

33

55

-

Iprscan [tmhmm]

70

92

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Fp1M2AZu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

41 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits