Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0544lpdANP_635936.1dihydrolipoamide dehydrogenase

lpdA XCC0544
XCC0543
XCC0543
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0545
XCC0545
ID lpdA
AC NP_635936.1
LT XCC0544
SY
OR NC_003902 from 658992 to 660839 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE dihydrolipoamide dehydrogenase
IP Biotin/lipoyl attachment; Mercuric reductase; Trypanothione reductase;
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: dihydrolipoyl dehydrogenase activity (GO:0004148)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 615 aa
 
........10........20........30........40........50
| | | | |
MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVVKDQGLVTLESDKATLEVPS
SAAGVVKELKVKIGDNLSEGAVVLLLETEGEAAAAPAAPKAETKAETKAA
APAAAPAAAAPGSKPPVTPSHRAPAEPAASKPALASGKAADIECKMVVLG
AGPGGYTAAFRAADLGLDTVLIERYASLGGVCLNVGCIPSKALLHAAAVI
DEVAHAGDFGVDFGQPKITLDKLREYKEKVVGKLTGGLASMAKQRKVRTV
TGVASFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRV
MDSTDALELHDIPKTLLVVGGGIIGLEMATVYSALGSKVTVVEFMDQLMP
GADKDLVKPLADRLKKQGVEVHLKTKATDVSADAKGITVSFEAATEGEKP
GLQATAFDRVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPH
IFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEWVARVIPSVAYTNPEI
AWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEETHR
IIGGAIVGVHAGDLLAEIGLAIEMGAEAEDIGHTIHAHPTLSESVGMAAE
VYDGTITDLYIPKKK
xansp

NP_636857.1 lcl|ldp-XCC1485

146

599

S=688 I=37 E=1.7371e-76

dihydrolipoamide dehydrogenase

xansp

NP_639231.1 lcl|XCC3891

147

550

S=416 I=30 E=1.4957e-43

mercuric reductase

xansp

NP_637927.1 lcl|XCC2579

160

595

S=332 I=28 E=2.10222e-33

reductase

xansp

NP_635934.1 lcl|phdB-XCC0542

1

76

S=282 I=78 E=2.30226e-27

dihydrolipoamide acetyltransferase

xansp

NP_635934.1 lcl|phdB-XCC0542

4

76

S=278 I=75 E=6.61182e-27

dihydrolipoamide acetyltransferase

xansp

NP_636858.1 lcl|sucB-XCC1486

5

76

S=111 I=36 E=1.41275e-06

dihydrolipoamide acetyltransferase

xansp

NP_635821.1 lcl|pdhB-XCC0427

5

73

S=108 I=39 E=3.12348e-06

branched-chain alpha-keto acid dehydrogenase subunit E2

pubmed

1

615

S=1553 I=53 E=2.93557e-179

Putative dihydrolipoamide dehydrogenase

Pubmed 18456849

 

prodomImg

pubmed

140

615

S=1352 I=59 E=6.94104e-155

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 8021225

 

prodomImg

pubmed

1

76

S=173 I=61 E=6.10626e-12

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 8021225

 

prodomImg

pubmed

139

615

S=1345 I=57 E=5.15609e-154

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 12819049

 

prodomImg

pubmed

139

615

S=1335 I=56 E=7.89763e-153

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cell inner membrane Cytoplasm FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 6352260,8202364

 

prodomImg

pubmed

139

615

S=1317 I=55 E=1.34199e-150

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 9620967

 

prodomImg

pubmed

137

615

S=1216 I=53 E=2.32131e-138

Outer membrane protein P64k or PM-6 ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 10234839

 

prodomImg

pubmed

1

76

S=147 I=53 E=7.77517e-09

Outer membrane protein P64k or PM-6 ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 10234839

 

prodomImg

pubmed

137

615

S=1185 I=54 E=1.43227e-134

Pyruvate dehydrogenase, E3 component, lipoamide dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 11559360

 

prodomImg

pubmed

1

76

S=148 I=54 E=5.48592e-09

Pyruvate dehydrogenase, E3 component, lipoamide dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 11559360

 

prodomImg

sp

141

615

S=1345 I=57 E=3.66845e-154

Dihydrolipoyl dehydrogenase - Vibrio cholerae

 

prodomImg

sp

139

615

S=1335 I=56 E=4.97333e-153

Dihydrolipoyl dehydrogenase - Shigella flexneri

 

prodomImg

sp

139

615

S=1335 I=56 E=4.97333e-153

Dihydrolipoyl dehydrogenase - Escherichia coli (strain K12)

Pubmed 6352260,8202364,2211531,16079137,

 

prodomImg

sp

139

615

S=1335 I=56 E=4.97333e-153

Dihydrolipoyl dehydrogenase - Escherichia coli O6

 

prodomImg

sp

139

615

S=1335 I=56 E=4.97333e-153

Dihydrolipoyl dehydrogenase - Escherichia coli O157:H7

 

prodomImg

Iprscan [PD000139]

284

355

-

Iprscan IPR013027 [PR00368]

145

167

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

279

288

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

315

340

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

408

422

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

451

458

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan [PR00411]

145

167

-

Iprscan [PR00411]

178

193

-

Iprscan [PR00411]

279

288

-

Iprscan [PR00411]

315

340

-

Iprscan [PR00411]

408

422

-

Iprscan [PR00411]

451

458

-

Iprscan [PR00411]

486

507

-

Iprscan [PR00411]

551

566

-

Iprscan [PR00411]

573

593

-

Iprscan IPR000815 [PR00945]

155

173

Mercuric reductase

Iprscan IPR000815 [PR00945]

315

332

Mercuric reductase

Iprscan IPR000815 [PR00945]

335

350

Mercuric reductase

Iprscan IPR000815 [PR00945]

522

542

Mercuric reductase

Iprscan IPR000815 [PR00945]

587

606

Mercuric reductase

Iprscan [G3DSA:2.40.50.100]

2

82

-

Iprscan IPR004099 [G3DSA:3.30.390.30]

489

614

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan [G3DSA:3.50.50.60]

142

483

-

Iprscan [PTHR22912]

147

599

-

Iprscan IPR006258 [PTHR22912:SF20]

147

599

Dihydrolipoamide dehydrogenase

Iprscan IPR001327 [PF00070]

315

415

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR000089 [PF00364]

4

76

Biotin/lipoyl attachment

Iprscan IPR004099 [PF02852]

490

599

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR013027 [PF07992]

145

462

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR006258 [TIGR01350]

143

609

Dihydrolipoamide dehydrogenase

Iprscan IPR012999 [PS00076]

179

189

Pyridine nucleotide-disulphide oxidoreductase, class I, active site

Iprscan IPR003016 [PS00189]

27

56

2-oxo acid dehydrogenase, lipoyl-binding site

Iprscan IPR000089 [PS50968]

4

76

Biotin/lipoyl attachment

Iprscan IPR011053 [SSF51230]

1

98

Single hybrid motif

Iprscan [SSF51905]

143

452

-

Iprscan IPR016156 [SSF55424]

487

608

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one w3COH2Cc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

347 hits
swiss-prot

Swiss-Prot ncbi-blastp

245 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

36 hits