Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0482bfrNP_635874.1bacterioferritin

bfr XCC0482
XCC0481
XCC0481
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0483
XCC0483
ID bfr
AC NP_635874.1
LT XCC0482
SY
OR NC_003902 from 579977 to 580447 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE bacterioferritin
IP Ferritin and Dps; Ferritin/ribonucleotide reductase-like
CL
EC
GO Biological Process: cellular iron ion homeostasis (GO:0006879)
Biological Process: iron ion transport (GO:0006826)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: transition metal ion binding (GO:0046914)
Molecular Function: ferric iron binding (GO:0008199)
PM
AN
SQ 156 aa
 
........10........20........30........40........50
| | | | |
MKGDTKVIEYLNKVLYNELTAINQYFLHAKMLKNWGLKELAEHEYKESID
EMKHADKLSDRILFLEGLPNFQALGKLRIGENPTEMFRCDLALEREAVVV
LREAVAYAETVKDYVSRQLFVDILESEEEHIDWLETQLDLVARIGEPNYL
LTKLDD
xansp

NP_636767.1 lcl|brf-XCC1393

1

155

S=230 I=38 E=8.21155e-22

bacterioferritin

pubmed

1

156

S=491 I=62 E=1.99369e-51

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 1549605,1904771

 

prodomImg

pubmed

1

154

S=474 I=60 E=2.26846e-49

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 2661540

 

prodomImg

pubmed

1

150

S=417 I=56 E=2.0312e-42

Bacterioferritin subunit 2 ; Heme Iron storage Metal-binding

Pubmed 9409768

 

prodomImg

pubmed

2

154

S=383 I=50 E=2.91969e-38

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 12897839

 

prodomImg

pubmed

1

149

S=367 I=50 E=2.20517e-36

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 7698330

 

prodomImg

pubmed

1

156

S=366 I=48 E=3.04469e-36

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 16980464

 

prodomImg

pubmed

1

151

S=355 I=46 E=6.66754e-35

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 8674981,11752777

 

prodomImg

pubmed

1

149

S=346 I=47 E=8.35704e-34

Bacterioferritin ; Cytoplasm Heme Iron storage Membrane Metal-binding

Pubmed 8006590

 

prodomImg

pubmed

1

145

S=345 I=48 E=1.13391e-33

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 1761687

 

prodomImg

pubmed

1

145

S=341 I=47 E=2.93298e-33

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 7959057

 

prodomImg

sp

1

156

S=491 I=62 E=1.29835e-51

Bacterioferritin - Azotobacter vinelandii

Pubmed 1549605,1904771,

 

prodomImg

sp

1

154

S=474 I=60 E=1.47729e-49

Bacterioferritin - Escherichia coli (strain K12)

Pubmed 2661540,2644932,7959070,9867433,7664064,

 

prodomImg

sp

1

154

S=474 I=60 E=1.47729e-49

Bacterioferritin - Escherichia coli O6

 

prodomImg

sp

1

149

S=473 I=61 E=2.2845e-49

Bacterioferritin - Serratia marcescens

 

prodomImg

sp

1

154

S=470 I=59 E=5.09505e-49

Bacterioferritin - Salmonella typhimurium

 

prodomImg

Iprscan [PD002269]

6

69

-

Iprscan IPR002024 [PR00601]

107

127

Bacterioferritin

Iprscan IPR002024 [PR00601]

128

149

Bacterioferritin

Iprscan IPR002024 [PR00601]

23

43

Bacterioferritin

Iprscan IPR002024 [PR00601]

3

22

Bacterioferritin

Iprscan IPR002024 [PR00601]

44

64

Bacterioferritin

Iprscan IPR002024 [PR00601]

65

85

Bacterioferritin

Iprscan IPR002024 [PR00601]

86

106

Bacterioferritin

Iprscan IPR012347 [G3DSA:1.20.1260.10]

1

156

Ferritin-related

Iprscan IPR002024 [PIRSF002560]

1

155

Bacterioferritin

Iprscan IPR008331 [PF00210]

8

144

Ferritin and Dps

Iprscan IPR002024 [TIGR00754]

1

156

Bacterioferritin

Iprscan IPR002024 [PS00549]

1

19

Bacterioferritin

Iprscan IPR009040 [PS50905]

1

145

Ferritin-like

Iprscan [seg]

91

106

-

Iprscan IPR009078 [SSF47240]

1

156

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VCoa37Du)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

27 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits