Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0270NP_635665.1quinone oxidoreductase

XCC0270
XCC0269
XCC0269
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0271
XCC0271
ID
AC NP_635665.1
LT XCC0270
SY
OR NC_003902 from 331992 to 333020 on strand -
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE quinone oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing;
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 342 aa
 
........10........20........30........40........50
| | | | |
MTSLTNRRIVLASRPHGEPGTDNFRIEDAPVPPTGHNQILVRNRFLSLDP
YMRGRMDEGPSYAAPVAIDAVMEGGTVGEVLESNHPDYHPGELLVLGGGW
QTHTVLEPTAPLRKLPKDDALPLSTALGVYGMPGFTAYAGLHEIGKPQAG
ETLVVAAASGPVGATVAQLARLQGLRVVAIAGGEEKVRYLRDTLRVDVAL
DHRAEDFAAQLRAATPDGIDVYFENVGGKVFDAVMPQLNDFARIPVCGVV
ATYNSRGQVAPGPDRLPDFIGQVLRKRLTVRGFIQHDFIRLMPAFLREMG
QWLREDKIQYREHVLHGLDSAPQGLISLLRGENFGKAVVALD
xansp

NP_636133.1 lcl|XCC0742

135

244

S=155 I=40 E=3.33178e-12

quinone reductase

pubmed

4

341

S=710 I=43 E=2.10232e-77

NADP-dependent oxidoreductase-like protein

Pubmed 17636987

 

prodomImg

pubmed

1

341

S=699 I=40 E=5.06727e-76

YfmJ protein

Pubmed 9272861

 

prodomImg

pubmed

4

342

S=631 I=39 E=7.99019e-68

Allyl alcohol dehydrogenase

Pubmed 11117876

 

prodomImg

pubmed

5

341

S=619 I=40 E=2.43706e-66

Probable NADP-dependent oxidoreductase P2 EC=1.3.1.74

Pubmed 7592828

 

prodomImg

pubmed

1

341

S=609 I=41 E=4.07294e-65

Probable NADP-dependent oxidoreductase P1 EC=1.3.1.74

Pubmed 7592828

 

prodomImg

pubmed

7

339

S=594 I=38 E=2.81935e-63

Prostaglandin reductase 1 EC=1.3.1.- EC=1.3.1.74 EC=1.3.1.48 ; Cytoplasm NADP Oxidoreductase

Pubmed 11733004,15007077

 

prodomImg

pubmed

7

341

S=572 I=37 E=1.17601e-60

Leukotriene B4

Pubmed 10800079

 

prodomImg

pubmed

7

339

S=562 I=37 E=1.96541e-59

Prostaglandin reductase 1 EC=1.3.1.- EC=1.3.1.74 EC=1.3.1.48 ; Cytoplasm NADP Oxidoreductase

Pubmed 8968041

 

prodomImg

pubmed

4

342

S=531 I=35 E=9.49995e-56

(+)-pulegone reductase

Pubmed 13679086

 

prodomImg

pubmed

6

339

S=526 I=35 E=4.93595e-55

Alcohol dehydrogenase-like protein

Pubmed 16150417

 

prodomImg

sp

6

339

S=959 I=57 E=9.83221e-108

Putative NADP-dependent oxidoreductase yncB - Escherichia coli (strain K12)

 

prodomImg

sp

5

341

S=619 I=40 E=1.54819e-66

Probable NADP-dependent oxidoreductase P2 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 7592828,

 

prodomImg

sp

1

341

S=609 I=41 E=2.58742e-65

Probable NADP-dependent oxidoreductase P1 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 7592828,

 

prodomImg

sp

7

339

S=594 I=38 E=1.79105e-63

NADP-dependent leukotriene B4 12-hydroxydehydrogenase - Cavia porcellus (Guinea pig)

 

prodomImg

sp

7

339

S=562 I=37 E=1.24856e-59

NADP-dependent leukotriene B4 12-hydroxydehydrogenase - Rattus norvegicus (Rat)

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

4

156

-

Iprscan IPR002085 [PTHR11695]

23

339

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF5]

23

339

-

Iprscan IPR013149 [PF00107]

149

301

Alcohol dehydrogenase, zinc-binding

Iprscan IPR011032 [SSF50129]

293

341

GroES-like

Iprscan IPR011032 [SSF50129]

3

151

GroES-like

Iprscan IPR016040 [SSF51735]

122

307

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WHqJXbwc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

82 hits
swiss-prot

Swiss-Prot ncbi-blastp

38 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits