Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0254NP_635649.1cytochrome C5

XCC0254
XCC0253
XCC0253
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0255
XCC0255
ID
AC NP_635649.1
LT XCC0254
SY
OR NC_003902 from 317784 to 318302 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE cytochrome C5
IP Cytochrome c, monohaem
CL
EC
GO Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: heme binding (GO:0020037)
PM
AN
SQ 172 aa
 
........10........20........30........40........50
| | | | |
MRNYDLEFLKKFSMVIGLLVVITLGLIALAAYLQRAVPDEVSPTAAKRLQ
QRIAPAGAVYAGTTGAAAQAAAQAAALAKASSQSAYGGSTDGKTIFDNLC
TACHTTGVGKAPTLDHSHWDARIAQGKDTLYKHAIEGYTGPDGGIMPAKG
GNPALTEEQVRATVDWMLSNLK
pubmed

92

172

S=168 I=43 E=3.64529e-12

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

Pubmed 188412,202947

 

prodomImg

pubmed

91

171

S=163 I=40 E=1.56343e-11

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

Pubmed 188412

 

prodomImg

pubmed

91

167

S=118 I=36 E=4.09796e-06

Soluble cytochrome cA

Pubmed 10781566

 

prodomImg

pubmed

88

167

S=116 I=30 E=7.81212e-06

Probable cytochrome C

Pubmed 16514165

 

prodomImg

sp

92

172

S=180 I=46 E=9.20085e-14

Cytochrome c-555 precursor - Chlorobium tepidum

 

prodomImg

sp

92

172

S=168 I=43 E=2.35726e-12

Cytochrome c-555 - Chlorobium limicola f.sp. thiosulfatophilum

Pubmed 188412,202947,

 

prodomImg

sp

91

171

S=163 I=40 E=1.01101e-11

Cytochrome c-555 - Prosthecochloris aestuarii

Pubmed 188412,

 

prodomImg

Iprscan IPR009056 [G3DSA:1.10.760.10]

86

167

Cytochrome c, monohaem

Iprscan IPR003088 [PF00034]

89

171

Cytochrome c, class I

Iprscan IPR009056 [PS51007]

87

171

Cytochrome c, monohaem

Iprscan [seg]

15

31

-

Iprscan [seg]

54

85

-

Iprscan [SignalP-NN(euk)]

1

30

-

Iprscan [SignalP-NN(euk)]

1

30

-

Iprscan [tmhmm]

12

34

-

Iprscan [tmhmm]

12

34

-

Iprscan IPR009056 [SSF46626]

14

170

Cytochrome c, monohaem

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VHYrMARK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits