Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0185glnANP_635580.1glutamine synthetase

glnA XCC0185
XCC0184
XCC0184
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0186
XCC0186
ID glnA
AC NP_635580.1
LT XCC0185
SY
OR NC_003902 from 241534 to 242943 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE glutamine synthetase
IP Glutamine synthetase type I
CL
EC
GO Biological Process: glutamine biosynthetic process (GO:0006542)
Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: nitrogen fixation (GO:0009399)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: glutamate-ammonia ligase activity (GO:0004356)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 469 aa
 
........10........20........30........40........50
| | | | |
MSVENVEKLIKDNKVEFVDLRFVDMRGVQQHITFPASIIEPALFEEGKMF
DGSSIAGWKGINESDMVLLPDAGTAYLDPFFADPTIVLTCDILDPATMQS
YERDPRGIAKRAEAYLKSSGTADQAFFGPEPEFFIFDSVRFANDMGHTFF
QVGSEEAAWNTGAKYDGGNSGYRPGVKGGYFPVPPTDTLHDLRAEMIKTL
EQVGIETEVHHHEVATAGQCEIGTKFSSLVQKADELLTMKYIIKNVAYRN
GKTATFMPKPIVGDNGSGMHVHQSLTKGGVNLFSGDGYGGLSQMALWYIG
GIFKHARAINAFANSGTNSYKRLVPGYEAPVMLAYSARNRSASCRIPWVT
NPKARRIEMRFPDPLQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYDL
PPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQE
VTKFRAATHPLEYQLYYGN
xansp

NP_637700.1 lcl|glnA-XCC2346

62

454

S=326 I=29 E=7.79829e-33

glutamine synthetase

xansp

NP_637702.1 lcl|glnA-XCC2348

201

398

S=208 I=34 E=1.74926e-18

glutamine synthase

pubmed

1

467

S=1795 I=69 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 1969923

 

prodomImg

pubmed

6

467

S=1690 I=66 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 11064198

 

prodomImg

pubmed

1

467

S=1687 I=66 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2574025

 

prodomImg

pubmed

1

467

S=1684 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2879772

 

prodomImg

pubmed

1

467

S=1681 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2882477,2874141

 

prodomImg

pubmed

1

467

S=1670 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 8095910

 

prodomImg

pubmed

1

467

S=1668 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 15644904

 

prodomImg

pubmed

8

467

S=1652 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nitrogen fixation Nucleotide-binding

Pubmed 1977737

 

prodomImg

pubmed

8

467

S=1615 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 16495669

 

prodomImg

pubmed

1

467

S=1608 I=62 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 11040434

 

prodomImg

sp

1

467

S=1795 I=69 E=0

Glutamine synthetase - Methylococcus capsulatus

Pubmed 1969923,

 

prodomImg

sp

1

467

S=1706 I=66 E=0

Glutamine synthetase - Vibrio cholerae

 

prodomImg

sp

1

467

S=1687 I=66 E=0

Glutamine synthetase - Vibrio alginolyticus

Pubmed 2574025,

 

prodomImg

sp

1

467

S=1684 I=64 E=0

Glutamine synthetase - Salmonella typhimurium

Pubmed 2879772,2572586,11329256,

 

prodomImg

sp

1

467

S=1684 I=64 E=0

Glutamine synthetase - Salmonella typhi

 

prodomImg

Iprscan [PD001057]

110

467

-

Iprscan [G3DSA:3.10.20.70]

1

104

-

Iprscan IPR014746 [G3DSA:3.30.590.10]

105

469

Glutamine synthetase/guanido kinase, catalytic region

Iprscan [PTHR20852]

17

468

-

Iprscan [PTHR20852:SF7]

17

468

-

Iprscan IPR008146 [PF00120]

102

383

Glutamine synthetase, catalytic region

Iprscan IPR008147 [PF03951]

14

95

Glutamine synthetase, beta-Grasp

Iprscan IPR004809 [TIGR00653]

4

468

Glutamine synthetase type I

Iprscan IPR008147 [PS00180]

50

68

Glutamine synthetase, beta-Grasp

Iprscan IPR008146 [PS00181]

259

274

Glutamine synthetase, catalytic region

Iprscan IPR008147 [SSF54368]

2

101

Glutamine synthetase, beta-Grasp

Iprscan [SSF55931]

102

469

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LAPYPrEd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

395 hits
swiss-prot

Swiss-Prot ncbi-blastp

81 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits