Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0011exbD2NP_635406.1biopolymer transport ExbD2 protein

exbD2 XCC0011
XCC0010
XCC0010
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0012
XCC0012
ID exbD2
AC NP_635406.1
LT XCC0011
SY
OR NC_003902 from 12549 to 12959 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE biopolymer transport ExbD2 protein
IP Biopolymer transport protein ExbD/TolR
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
PM
AN
SQ 136 aa
 
........10........20........30........40........50
| | | | |
MAFSTGGNRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVDLPQRV
LNPPPQTTEPPPPIELRIDASNQVFWNNSPTPVAQLQQKMEEVVQADPTN
QPELRIDANEDAEYEVMAKVLAAAKNSQMKKIGFMQ
xansp

NP_635405.1 lcl|exbD1-XCC0010

1

135

S=246 I=38 E=7.84323e-24

biopolymer transport ExbD1 protein

xansp

NP_638367.1 lcl|tolR-XCC3020

13

47

S=111 I=63 E=1.74115e-07

TolR protein

pubmed

1

136

S=633 I=92 E=9.03143e-69

Biopolymer transport protein exbD2 ; Cell inner membrane Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

1

136

S=628 I=91 E=3.80654e-68

ExbD2 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

135

S=246 I=38 E=7.61927e-22

ExbD1 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

135

S=246 I=38 E=7.61927e-22

Biopolymer transport protein exbD1 ; Cell inner membrane Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

1

135

S=237 I=37 E=9.30337e-21

ExbD protein (Biopolymer transport protein ExbD/TolR) ; Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

1

135

S=235 I=36 E=1.52922e-20

ExbD ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

1

135

S=206 I=36 E=4.61603e-17

ExbD ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

1

135

S=192 I=34 E=2.95415e-15

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

7

135

S=185 I=35 E=2.10085e-14

Biopolymer transport protein ; Transmembrane

Pubmed 16309397

 

prodomImg

pubmed

1

135

S=184 I=33 E=2.35299e-14

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

sp

1

136

S=633 I=92 E=5.82691e-69

Biopolymer transport protein exbD2 - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

1

135

S=246 I=38 E=4.91581e-22

Biopolymer transport protein exbD1 - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

1

135

S=192 I=34 E=1.90596e-15

Biopolymer transport protein exbD - Neisseria meningitidis serogroup C

Pubmed 9006036,

 

prodomImg

sp

1

135

S=192 I=34 E=1.90596e-15

Biopolymer transport protein exbD - Neisseria meningitidis serogroup B

 

prodomImg

sp

1

135

S=192 I=34 E=1.90596e-15

Biopolymer transport protein exbD - Neisseria meningitidis serogroup A

 

prodomImg

Iprscan IPR003400 [PF02472]

8

131

Biopolymer transport protein ExbD/TolR

Iprscan [seg]

53

63

-

Iprscan [SignalP-NN(euk)]

1

39

-

Iprscan [SignalP-NN(euk)]

1

39

-

Iprscan [tmhmm]

20

42

-

Iprscan [tmhmm]

20

42

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jLwG9oN2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits