Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0009exbBNP_635404.1biopolymer transport ExbB protein

exbB XCC0009
XCC0008
XCC0008
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0010
XCC0010
ID exbB
AC NP_635404.1
LT XCC0009
SY
OR NC_003902 from 11315 to 12076 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE biopolymer transport ExbB protein
IP MotA/TolQ/ExbB proton channel
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: protein transporter activity (GO:0008565)
PM
AN
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MLQEFVIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVVLITLI
AMSAASWYWTVINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPAS
EPFSKIALDAAQAAAHHQRAEGSTGGMGESLSRSEFVDRALRQAVTREST
KLQSGMTLLATVGATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPV
GEALIMTAIGLFVAIPAVFAFNFFSKVNSSVIAKFDTFAHDLHDFFATGS
RVR
xansp

NP_638368.1 lcl|tolQ-XCC3021

135

241

S=230 I=47 E=1.88205e-21

TolQ protein

xansp

NP_637483.1 lcl|exbB-XCC2122

151

244

S=134 I=31 E=6.65995e-10

biopolymer transport protein

pubmed

1

253

S=1167 I=91 E=6.96791e-133

ExbB ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

253

S=1167 I=91 E=6.96791e-133

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

23

252

S=436 I=41 E=2.21352e-44

ExbB protein (MotA/TolQ/ExbB proton channel family protein) ; transport Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

23

252

S=430 I=40 E=1.40548e-43

ExbB ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

37

250

S=406 I=43 E=8.75516e-41

ExbB ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

45

243

S=359 I=39 E=4.49069e-35

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

pubmed

45

243

S=352 I=38 E=3.33587e-34

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

40

245

S=314 I=34 E=1.52896e-29

ExbB (Transport protein ExbB) ; Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

126

242

S=285 I=44 E=4.45707e-26

TolQ protein ; transport Transmembrane

Pubmed 10678921

 

prodomImg

pubmed

126

242

S=285 I=44 E=4.45707e-26

ExbB (Cytoplasmic membrane protein) ; transport Transmembrane

Pubmed 12742718

 

prodomImg

sp

1

253

S=1167 I=91 E=4.39714e-133

Biopolymer transport protein exbB - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

45

243

S=359 I=39 E=2.83388e-35

Biopolymer transport protein exbB - Neisseria gonorrhoeae

Pubmed 9140974,

 

prodomImg

sp

45

243

S=358 I=39 E=3.68109e-35

Biopolymer transport protein exbB - Neisseria meningitidis serogroup B

 

prodomImg

sp

45

243

S=358 I=39 E=3.68109e-35

Biopolymer transport protein exbB - Neisseria meningitidis serogroup A

 

prodomImg

sp

45

243

S=352 I=38 E=2.10512e-34

Biopolymer transport protein exbB - Neisseria meningitidis serogroup C

Pubmed 9006036,

 

prodomImg

Iprscan IPR002898 [PF01618]

100

240

MotA/TolQ/ExbB proton channel

Iprscan [seg]

110

120

-

Iprscan [seg]

8

19

-

Iprscan [tmhmm]

161

183

-

Iprscan [tmhmm]

161

183

-

Iprscan [tmhmm]

203

225

-

Iprscan [tmhmm]

203

225

-

Iprscan [tmhmm]

39

61

-

Iprscan [tmhmm]

39

61

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9KpCHQoo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

45 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits