Xanthomonas campestris pv. campestris str. ATCC 33913

  1. XCC0008tonBNP_635403.1TonB protein

tonB XCC0008
XCC0007
XCC0007
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCC0009
XCC0009
ID tonB
AC NP_635403.1
LT XCC0008
SY
OR NC_003902 from 10559 to 11230 on strand +
OS Xanthomonas campestris pv. campestris str. ATCC 33913
DE TonB protein
IP Gram-negative bacterial tonB protein
CL
EC
GO Biological Process: protein transport (GO:0015031)
Biological Process: iron ion transport (GO:0006826)
Cellular Component: membrane (GO:0016020)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)
Molecular Function: protein transporter activity (GO:0008565)
PM
AN
SQ 223 aa
 
........10........20........30........40........50
| | | | |
MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPAVAPKA
PAEKERTTMVTLVDAPPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPP
PEAPVVDVPEPRPSDIVTPPSPPAPPAPPSDIGASVDISSKNMNPPKYPP
AAFRAGVQGEVILIVDVDANGNVTNVSVEKSSRNRDLDRAAMDAARKWKF
NASTVNGQKAAGRVRVPVNFALN
xansp

NP_637446.1 lcl|XCC2081

134

220

S=123 I=31 E=1.14116e-08

hypothetical protein

xansp

NP_637960.1 lcl|tonB-XCC2612

146

223

S=123 I=39 E=1.26703e-08

TonB like protein

xansp

NP_638551.1 lcl|XCC3205

138

223

S=111 I=28 E=3.69967e-07

TonB-like protein

xansp

NP_636964.1 lcl|XCC1593

142

220

S=97 I=35 E=2.11398e-05

hypothetical protein

xansp

NP_639306.1 lcl|XCC3967

146

201

S=94 I=30 E=3.89186e-05

TonB-like protein

pubmed

1

223

S=628 I=61 E=1.07966e-67

TonB

Pubmed 12646254

 

prodomImg

pubmed

1

223

S=628 I=61 E=1.07966e-67

Protein tonB ; Cell inner membrane Periplasm transport Repeat Signal-anchor Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

144

223

S=117 I=35 E=8.61132e-06

Protein tonB2 ; Cell inner membrane Periplasm transport Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

145

223

S=116 I=34 E=1.09924e-05

TonB protein

Pubmed 15689115

 

prodomImg

sp

1

223

S=628 I=61 E=6.82493e-68

Protein tonB - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

144

223

S=117 I=35 E=5.44355e-06

Protein tonB2 - Pseudomonas aeruginosa

Pubmed 10689178,

 

prodomImg

Iprscan [PR01217]

104

129

-

Iprscan [PR01217]

46

67

-

Iprscan [PR01217]

67

83

-

Iprscan [PR01217]

84

101

-

Iprscan IPR003538 [PR01374]

140

161

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

161

179

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

69

79

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PF03544]

145

179

Gram-negative bacterial tonB protein

Iprscan IPR006260 [TIGR01352]

146

223

TonB, C-terminal

Iprscan [seg]

119

130

-

Iprscan [seg]

183

196

-

Iprscan [seg]

44

55

-

Iprscan [seg]

66

113

-

Iprscan [SignalP-NN(euk)]

1

38

-

Iprscan [SignalP-NN(euk)]

1

38

-

Iprscan [tmhmm]

21

43

-

Iprscan [tmhmm]

21

43

-

Iprscan [SSF74653]

92

223

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0bcZCw9V)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
trembl

TrEMBL ncbi-blastp

0 hits
xancp

Xanthomonas campestris pv. campestris str. ATCC 33913 proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits